Gene Information

Name : GM21_3720 (GM21_3720)
Accession : YP_003023497.1
Strain : Geobacter sp. M21
Genome accession: NC_012918
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4285198 - 4285872 bp
Length : 675 bp
Strand : +
Note : KEGG: gbm:Gbem_3615 two component heavy metal response transcriptional regulator, winged helix family; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGCGCATCCTGATCGTCGAGGACGAACAAAAGGCCGCCAACTATCTCAAAAAGGGGCTTACCGAGAACGGCTTCAGCGT
GGACATCGCCAACGACGGCGAGGACGGGCTGCACCTGGCCCTGACCGAGGTGTACAGCCTGATCATCCTCGACGTGATGC
TGCCGATTCGCGGCGGATGGTCCATCATCAAGGAGCTGCGCGCGGCGGGAAACGACGTCCCCGTCATCTTCCTGTCGGCG
CGCGACGAGGTGCACGACCGGGTGCACGGCCTGGAGCTTGGCGCCGACGATTACCTGGTGAAACCCTACGCCTTCTCGGA
GCTTCTGGCCCGCATCCGCATCATCCTGCGCCGCTGCCCGCTGCAGCAATCCGAGTCCATGAAGCTGGCCGACCTGGAGT
TGGACCTGATCCGGCACAAGGCCCGGCGCGGGGGGCGCTCGCTCGACCTCACCGTCAAGGAATTCCAGCTTCTGGCCCTG
ATGCTGCGCCGGCACGGCGAGGTCTTAAGCCGCACCACCATCTCCGAACAGGTCTGGGGCATCAACTTCGACACCGACAC
CAACGTGGTGGACGTGGCTATCAGGAGGCTCAGGAAGAAGGTCGACGACCCCTTCCCGGTCAAGCTCATCCAAACCATAA
GGGGAGTAGGCTATGTCCTCGACGAGTGCGCCTGA

Protein sequence :
MRILIVEDEQKAANYLKKGLTENGFSVDIANDGEDGLHLALTEVYSLIILDVMLPIRGGWSIIKELRAAGNDVPVIFLSA
RDEVHDRVHGLELGADDYLVKPYAFSELLARIRIILRRCPLQQSESMKLADLELDLIRHKARRGGRSLDLTVKEFQLLAL
MLRRHGEVLSRTTISEQVWGINFDTDTNVVDVAIRRLRKKVDDPFPVKLIQTIRGVGYVLDECA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-52 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-51 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 5e-62 63
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 5e-59 62
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 4e-53 58
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 3e-56 56
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 2e-59 55
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 8e-51 55
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 1e-55 54
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 6e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 6e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 6e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 6e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 6e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 6e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 6e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 6e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 8e-29 44
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-29 43
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 1e-52 55
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 8e-33 45
GM21_3720 YP_003023497.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 3e-38 42