Name : emrE (ECBD_3115) Accession : YP_003037302.1 Strain : Escherichia coli Escherichia coli BL21-Gold(DE3)pLysS AG Genome accession: NC_012947 Putative virulence/resistance : Resistance Product : multidrug efflux protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 3245142 - 3245474 bp Length : 333 bp Strand : - Note : member of the small MDR (multidrug resistance) family of transporters; in Escherichia coli this protein provides resistance against a number of positively charged compounds including ethidium bromide and erythromycin; proton-dependent secondary transporte DNA sequence : ATGAACCCTTATATTTATCTTGGTGGTGCAATACTTGCAGAGGTCATTGGTACAACCTTAATGAAGTTTTCAGAAGGTTT TACACGGTTATGGCCATCTGTTGGTACAATTATTTGTTATTGTGCATCATTCTGGTTATTAGCTCAGACGCTGGCTTATA TTCCTACAGGGATTGCTTATGGTATCTGGTCAGGAGTCGGTATTGTCCTGATTAGCTTACTGTTATGGGGATTTTTCGGC CAACGGCTGGACCTGCCAGCCATTATAGGCATGATGTTGATTTGTGCCGGTGTGTTGGTTATTAATTTATTGTCACGAAG CACACCACATTAA Protein sequence : MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYGIWSGVGIVLISLLLWGFFG QRLDLPAIIGMMLICAGVLVINLLSRSTPH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 1e-12 | 43 |
qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-12 | 43 |
qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 2e-12 | 43 |
qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 1e-12 | 43 |
qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 1e-12 | 43 |
qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 1e-12 | 43 |
qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 1e-12 | 43 |
qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 1e-12 | 43 |
qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 1e-12 | 43 |
ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 2e-12 | 43 |
qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 1e-12 | 43 |
qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-12 | 43 |
qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-12 | 43 |
qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-12 | 43 |
qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-12 | 43 |
qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 1e-12 | 43 |
qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 1e-12 | 43 |
ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 2e-12 | 43 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
emrE | YP_003037302.1 | multidrug efflux protein | NC_002695.1.913273.p | Protein | 2e-45 | 98 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0150 | Protein | 2e-45 | 98 |
emrE | YP_003037302.1 | multidrug efflux protein | CP004022.1.gene1549. | Protein | 1e-23 | 59 |
emrE | YP_003037302.1 | multidrug efflux protein | CP001138.1.gene1489. | Protein | 2e-23 | 58 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0377 | Protein | 8e-22 | 55 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0002 | Protein | 1e-18 | 51 |
emrE | YP_003037302.1 | multidrug efflux protein | NC_010410.6003348.p0 | Protein | 1e-18 | 51 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0324 | Protein | 1e-18 | 50 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0249 | Protein | 6e-11 | 48 |
emrE | YP_003037302.1 | multidrug efflux protein | AE000516.2.gene3301. | Protein | 6e-11 | 48 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0322 | Protein | 2e-17 | 47 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0323 | Protein | 5e-13 | 43 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0140 | Protein | 1e-13 | 41 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0192 | Protein | 1e-12 | 41 |
emrE | YP_003037302.1 | multidrug efflux protein | BAC0327 | Protein | 2e-14 | 41 |