Gene Information

Name : ECBD_0051 (ECBD_0051)
Accession : YP_003034316.1
Strain : Escherichia coli Escherichia coli BL21-Gold(DE3)pLysS AG
Genome accession: NC_012947
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 49966 - 50331 bp
Length : 366 bp
Strand : -
Note : PFAM: protein of unknown function DUF1219; KEGG: sfx:S3204 hypothetical protein

DNA sequence :
ATGTCTTGCCCAATACGGGAGGCATCGCGCTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTCACCCGACTGCTGGA
CCAGCACTACGGCCTCACGCTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTGAGGCAGGGATTT
CACTGTGTGACGCGGTGAACTTTCTCGTTGAAAAATACGCGCTGGTACGTACCGACCAGCTGGGATTCAGCGCAGGAGCC
CCGTCGCAGTTAATCAACAGCATTGATATTCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGGAACAATTACAGAAT
GGTAAATAACATTACCCAGGGCAAGCATCCGGAGGCAAAACGATGA

Protein sequence :
MSCPIREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQLGFSAGA
PSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 7e-49 97
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 6e-48 97
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 2e-47 94
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 1e-47 94
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 2e-47 94
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 4e-47 94
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 4e-46 92
unnamed AAL57575.1 unknown Not tested LEE Protein 9e-45 91
unnamed AAC31486.1 L0007 Not tested LEE Protein 4e-45 91
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 6e-45 91
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 4e-45 91
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 6e-45 91
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 2e-44 90
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 1e-44 90
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-45 90
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 9e-44 90
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 2e-44 89
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-43 89
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-44 89
unnamed AAL08478.1 unknown Not tested SRL Protein 6e-44 89
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 5e-44 88
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 5e-44 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECBD_0051 YP_003034316.1 hypothetical protein VFG0663 Protein 5e-48 94
ECBD_0051 YP_003034316.1 hypothetical protein VFG0786 Protein 2e-45 91
ECBD_0051 YP_003034316.1 hypothetical protein VFG1682 Protein 4e-45 90
ECBD_0051 YP_003034316.1 hypothetical protein VFG1620 Protein 7e-45 90
ECBD_0051 YP_003034316.1 hypothetical protein VFG1530 Protein 4e-44 90
ECBD_0051 YP_003034316.1 hypothetical protein VFG1069 Protein 2e-44 89