Gene Information

Name : PAU_01965 (PAU_01965)
Accession : YP_003040801.1
Strain : Photorhabdus asymbiotica ATCC 43949
Genome accession: NC_012962
Putative virulence/resistance : Resistance
Product : methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre)
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2201540 - 2201872 bp
Length : 333 bp
Strand : +
Note : Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins. They confer resistance to a wide range of toxic compounds by removing them for the cells.

DNA sequence :
ATGAATGGATTTGTATATTTAGCAATGGCAATTGTGGCTGAAGTCGTAGCAACGGCTTCATTAAAAGCCTCCGATGGGTT
CAGTAAATTGTTTCCTTCTATACTGGTCATCGTTGGGTATGGTATCGCTTTCTGGGGATTATCTCAGGTAGTCAAAGTTG
TTCCATTAGGAATTGCTTATGCGATATGGTCTGGCCTTGGTATTGTGTTGGTTTCCATTGCGGCGATATTTTTATATCAG
CAGAAGTTGGATTGGGCGGCTATTTTAGGTATGGTGCTCATCATTGCTGGTGTGATGGTAATAAATTTGCTTTCTAACAG
CAGTGCACATTAA

Protein sequence :
MNGFVYLAMAIVAEVVATASLKASDGFSKLFPSILVIVGYGIAFWGLSQVVKVVPLGIAYAIWSGLGIVLVSIAAIFLYQ
QKLDWAAILGMVLIIAGVMVINLLSNSSAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-18 54
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 4e-18 54
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-18 54
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-18 54
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-18 54
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-18 54
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-18 54
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-18 54
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-18 54
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-18 54
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 4e-18 54
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-18 54
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-18 54
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-18 54
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-18 54
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-18 54
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-18 54
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-18 54
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-18 54
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 4e-18 54
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 4e-18 42
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 5e-13 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) CP004022.1.gene1549. Protein 1e-35 75
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0377 Protein 6e-36 73
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0322 Protein 1e-22 57
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0324 Protein 1e-20 55
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) CP001138.1.gene1489. Protein 3e-21 55
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0323 Protein 1e-18 54
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0002 Protein 4e-20 53
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) NC_010410.6003348.p0 Protein 4e-20 53
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0150 Protein 1e-21 52
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) NC_002695.1.913273.p Protein 1e-21 52
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0329 Protein 2e-16 50
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0326 Protein 1e-15 45
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0140 Protein 8e-13 43
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0321 Protein 6e-19 42
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0477 Protein 1e-08 42
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) BAC0216 Protein 4e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) VFG1586 Protein 1e-18 42
PAU_01965 YP_003040801.1 methylviologen resistance protein encoded within prophage cp-933 (integral membrane drug resistance protein emre) VFG1587 Protein 2e-13 42