Gene Information

Name : yeeV (ECB_02808)
Accession : YP_003045995.1
Strain : Escherichia coli REL606
Genome accession: NC_012967
Putative virulence/resistance : Virulence
Product : toxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3009295 - 3009669 bp
Length : 375 bp
Strand : +
Note : similar to b2005

DNA sequence :
ATGAACACATTACCCGACACACACGTACGGAAGGCATCGCGCTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTGTC
CCGACTACTGGGCCAGCATTACGGCCTTACACTGAATGACACACCGTTCGCCGATGAACGTGTGATTGAGCAGCATATTG
AAGCTGGCATTTCACTGTGTGACGCGGTGAACTTTCTCGTGGAAAAATACGCGCTGGTGCGTACCGACCAGCCGGGATTC
AGCACTTGTCCCCGCTCTCAGTTAATAAACAGTATTGATATCCTCCGGGCTCGCCGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCCTGGGTAAGCATCCGGAGAAACGATGA

Protein sequence :
MNTLPDTHVRKASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 7e-54 98
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 7e-54 98
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-51 95
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 3e-51 93
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-52 93
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 6e-52 93
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 5e-52 92
unnamed AAL08478.1 unknown Not tested SRL Protein 6e-51 92
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 8e-52 92
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 8e-52 92
unnamed AAC31486.1 L0007 Not tested LEE Protein 5e-52 92
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-50 92
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 7e-50 92
unnamed AAL57575.1 unknown Not tested LEE Protein 3e-50 91
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 6e-49 91
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 4e-51 91
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 4e-49 91
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 6e-49 91
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 8e-49 90
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 7e-48 90
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 6e-49 88
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 5e-48 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeV YP_003045995.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1530 Protein 1e-51 93
yeeV YP_003045995.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1069 Protein 3e-51 92
yeeV YP_003045995.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0786 Protein 2e-52 92
yeeV YP_003045995.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1682 Protein 3e-50 92
yeeV YP_003045995.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1620 Protein 2e-51 91
yeeV YP_003045995.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0663 Protein 2e-49 91