Gene Information

Name : Dfer_0274 (Dfer_0274)
Accession : YP_003084709.1
Strain : Dyadobacter fermentans DSM 18053
Genome accession: NC_013037
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 311512 - 312210 bp
Length : 699 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: fjo:Fjoh_3400 two component transcriptional regulator

DNA sequence :
ATGAAGCTTCTGCTCATCGAAGATGAGCCTAACGTTATATCGCTGATCCAACGCAGTCTCACAGCCAACGGCCACGAAAT
CACCATTGCGATGGACGGGCAGTCGGGTTTGCAGATGGTGTTGCAGCACCAGTTCGACGTCATTATCCTCGACCTGATGA
TCCCGATCATTAACGGCATGGAGGTGTGCCGCCGGGCGCGCAATGCACAGGTTACCACGCCGATCCTCATGCTCACCGCA
CTCGGTACGACCGAAAATATCGTTTCCGGACTCGATTCCGGAGCTGATGACTACATGACCAAGCCATTCAAGCTGGCTGA
GCTCGAAGCGCGCCTGCGGACGCTGATACGCCGCGGGAAGGAGCCCGAAAAGGAGAAAAACGACAAAGTACTTACGCTCG
GCGACCTCGTGCTCGACAAGGTAACCAAAACCGTGAAGCGGGGAGGGCAGCCGATCGAACTCACCGCCACGGAATTTCGC
CTGCTCGAATACCTGCTTTCTAATACAAACCGCGTGCTGAACCGCATGGAAATACTTGAAAATGTGTGGGATATCAATTT
CAACCTGGGCACGAACGTGGTGGATGTTTACATCAACTACCTCCGTAAAAAGATCGATAAGAACCACGATATTAAACTGA
TCCACACTGTTTTCGGAATGGGCTACGTGATCCGCCAGTCGTATGAGGATACAAAATAA

Protein sequence :
MKLLLIEDEPNVISLIQRSLTANGHEITIAMDGQSGLQMVLQHQFDVIILDLMIPIINGMEVCRRARNAQVTTPILMLTA
LGTTENIVSGLDSGADDYMTKPFKLAELEARLRTLIRRGKEPEKEKNDKVLTLGDLVLDKVTKTVKRGGQPIELTATEFR
LLEYLLSNTNRVLNRMEILENVWDINFNLGTNVVDVYINYLRKKIDKNHDIKLIHTVFGMGYVIRQSYEDTK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-43 46
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-43 46
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-43 46
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-43 46
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-43 46
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-43 46
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-43 46
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-43 46
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-39 45
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 9e-40 45
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-42 45
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-38 44
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-40 44
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-36 44
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-36 42
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-34 42
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-50 45
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-36 43
Dfer_0274 YP_003084709.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-43 41