Gene Information

Name : Amir_5698 (Amir_5698)
Accession : YP_003103359.1
Strain : Actinosynnema mirum DSM 43827
Genome accession: NC_013093
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6728338 - 6729006 bp
Length : 669 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: ade:Adeh_3856 two component transcriptional regulator

DNA sequence :
GTGCGCATACTCGTCGTCGAGGACGACGACCGGGTGGCGCGTGGTCTGCTCACCGCGCTGCGGCACGCGGGTTACGAGGT
CCACCGGGCGGCGTCGGCCGCCGCGGCCCTCGCCGCCGCCCCGGTCGACGTCGTGCTGCTCGACCTGGGTCTGCCGGACG
GCGACGGCCTGGACGTGCTCCGCGAGCTGCGCGACCGTCGGGGCACCGCGGTGATCGCGGTGACCGCGCGCGGCGAGGAG
CGCGAGCGGGTGCTGGGGCTGCGCGCGGGCGCCGACGACTACGTCGTCAAGCCGTTCGGCACGGCGGAGCTGCTGGCCAG
GATCGAGGCGGTGCTGCGCCGCACCCGCGACGCGCGCGCCGGGTCCGGCCGCTCCGAGGCGCTGGAGCTGGGCCCGCTCA
CCCTGGACCCGGCCACCCGCGAGGCGCGCGTGGCGGACCGCCCGCTGGCGCTGACCCGCAAGGAGTTCGACCTGCTGGCC
CTGCTGGTCGGCAGGGCGGGGTCGGTGGTGAGCCGGGACCTGATCGTCGACCAGGTCTGGAAGGCGCACTGGGAGGCGCC
GTCGCGCACCCTGGACACCCACATCGCCGCGCTGCGCGGCAAGCTCGGCGCGGAGGTCCGCATCGAGACCGTGCGCGGCG
TCGGCTACCGCATCGTCGTCACCCCGTGA

Protein sequence :
MRILVVEDDDRVARGLLTALRHAGYEVHRAASAAAALAAAPVDVVLLDLGLPDGDGLDVLRELRDRRGTAVIAVTARGEE
RERVLGLRAGADDYVVKPFGTAELLARIEAVLRRTRDARAGSGRSEALELGPLTLDPATREARVADRPLALTRKEFDLLA
LLVGRAGSVVSRDLIVDQVWKAHWEAPSRTLDTHIAALRGKLGAEVRIETVRGVGYRIVVTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-17 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-17 42
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 9e-18 42
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator BAC0533 Protein 9e-18 42
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 6e-17 42
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 5e-17 41
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-17 41
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 5e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-20 42
Amir_5698 YP_003103359.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-17 42