Gene Information

Name : Cpin_1247 (Cpin_1247)
Accession : YP_003120946.1
Strain : Chitinophaga pinensis DSM 2588
Genome accession: NC_013132
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1492267 - 1492974 bp
Length : 708 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: two component transcriptional regulator, winged helix family

DNA sequence :
ATGAAACTTTTACTAATAGAAGATGAACCGTCGGTAGTCTCCTTTATACGGCGCTATCTTGCAGAAGCCGGCTATGATGT
CAGTGTTGCACTGGATGGTCAGTCGGGACTACAGATGGCCACCGAAAATAACTTTCAGCTGATCATCCTCGATGTCATGC
TGCCGGGTATGAACGGTATTGCCGTGTGTAAGGCTTTGCGACAACAACAATTAACCACGCCTATCCTTATGCTGACCGCT
TTGGGCTCCACCGAAAACGTAGTGGCAGGCCTTGACAGCGGTGCTGACGACTATCTGGTAAAACCGTTCAAACAGGCCGA
ATTACTGGCCCGTATCCGCTCCCTGCTGCGTCGTAACAATGACACAGCTGCCGCAGCTACACCAGCTGTAACACAGAGTA
ACGGTAATGTGCTGAAAGTAGCCGATCTGGAACTGGACCTCAATACCAAAAGCGCCAGCAGATACGGACAAACCATTGTG
CTGACCGCTACCGAATACCGGCTGCTGGAATATATGATGCGCAATCCCAAAAGGGTATTATCCAGGATGGAAATACTGGA
AAACGTCTGGGGCGTTGACTTTAATATGAATACCAAAGTAGTGGACGTATACGTCAATTACCTGCGTAAAAAAGTAAACC
GCAAAGACCAGCCGGCACTGATACAGACAGTGGTCGGTATGGGATATATGCTTAAAGAAGAAGAATGA

Protein sequence :
MKLLLIEDEPSVVSFIRRYLAEAGYDVSVALDGQSGLQMATENNFQLIILDVMLPGMNGIAVCKALRQQQLTTPILMLTA
LGSTENVVAGLDSGADDYLVKPFKQAELLARIRSLLRRNNDTAAAATPAVTQSNGNVLKVADLELDLNTKSASRYGQTIV
LTATEYRLLEYMMRNPKRVLSRMEILENVWGVDFNMNTKVVDVYVNYLRKKVNRKDQPALIQTVVGMGYMLKEEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-38 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-38 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator BAC0125 Protein 8e-43 45
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-44 45
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-39 44
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-42 44
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-41 43
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-41 43
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-41 43
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-41 43
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-41 43
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-41 43
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-41 43
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-41 43
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-34 42
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-34 42
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-46 45
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator VFG0596 Protein 9e-39 44
Cpin_1247 YP_003120946.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-39 42