Gene Information

Name : Cyan8802_2120 (Cyan8802_2120)
Accession : YP_003137842.1
Strain : Cyanothece sp. PCC 8802
Genome accession: NC_013161
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2127615 - 2128193 bp
Length : 579 bp
Strand : +
Note : PFAM: stress protein; KEGG: hso:HS_0633 stress response protein

DNA sequence :
ATGGGTATTTCTCTGAGTAAAGGGGAAAGAATCTCATTAGAAAAAGTTTCCCCTGGACTAGAAGCTGCCTTAGTGGGACT
AGGATGGAATGTCAAAAGAGTCGATACAGGCAAAGATTATGATATCGATGTTTCAGTATTTATGTTAGGGGCTGATGAAA
AGCTTCCATCCGATCAACACTTCATTTTCTATAATAATTTAAAAAGTCCTGATTCTGACCACTGCGTCGAACACATGGGA
GACAATTTAACCGGTGCAGGGGAAGGCGACGATGAAGTCATTCTCGTTAACCTCACAAAAATTCCAGCAAATATCCAAAA
ATTAGTCTTTGTTGTTACCATCCATCAAGCTGATGAACGAGGTCAAAATTTTGGTCAAATTGAGAATGCTTTTGTCCGTC
TAGTGGATGTCAAAACCAAACAAGAAATCCTGCGCTATGATTTAACCGAAGATTGCTCCATTGAAACCGCAATGGTTATG
GCAGAAATCTACAATAAAGACAATCAATGGCGTATGAGTGCAGTCGGTTCAGGATATCAAGGAGGGTTACAAGCCATTCT
CAATCGCTATCAAAACTAG

Protein sequence :
MGISLSKGERISLEKVSPGLEAALVGLGWNVKRVDTGKDYDIDVSVFMLGADEKLPSDQHFIFYNNLKSPDSDHCVEHMG
DNLTGAGEGDDEVILVNLTKIPANIQKLVFVVTIHQADERGQNFGQIENAFVRLVDVKTKQEILRYDLTEDCSIETAMVM
AEIYNKDNQWRMSAVGSGYQGGLQAILNRYQN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-49 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-44 51
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-43 51
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-43 51
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 49
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 49
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-47 48
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-42 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan8802_2120 YP_003137842.1 stress protein BAC0390 Protein 4e-47 52
Cyan8802_2120 YP_003137842.1 stress protein BAC0389 Protein 1e-47 50