Gene Information

Name : Cyan8802_2657 (Cyan8802_2657)
Accession : YP_003138353.1
Strain : Cyanothece sp. PCC 8802
Genome accession: NC_013161
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2680740 - 2681492 bp
Length : 753 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sde:Sde_3703 two component transcriptional regulator

DNA sequence :
ATGCTATCTCTGGACTTAGCTGAGTCTTCATCCTTAGAGAAAATCGTCCCTAACCATCGAATTTTAGTCGTTGAAGACGA
GGATGTGATTCGGGATATGATCACCATTGCCTTAGAAGAACAAGGCTACGAAGTGATAACAGCAAGCGATGGACGAACCG
CTTTAAACTTATTACAAGATGTTGCCACCCTAGGAACTGAGTCAGGTTTTGACCTAGTGGTACTGGATTTAATGTTACCT
CAGGTTAATGGCTTGGATATCTGCCGCCTGCTACGTTATAATAACAATATTGTACCTATTCTGATCCTCAGTGCCAAAGC
CAGCGAAACCGACCGGGTACTAGGATTAGAAGTGGGAGCCGATGATTATCTAACGAAACCCTTTAGTATGCGCGAGTTAG
TCGCGCGGTGTCGTGCTTTAATTCGTCGTCAAGACTTTAACAACGTTTCCTCCGCCCCAGTTCGTAAGTTCAAAGATATT
AGCCTTTATCCCGAAGAATGTCGGGTAGTTGTTCGTGGAGAAGAAATTAACCTTTCTCCTAAAGAATATCGTCTATTAGA
GCTATTTATGAGTTATCCTCGTCGGGTTTGGTCCCGTGAACAGTTGATTGATCAAGTGTGGGGGGCTGATTTCCTAGGAG
ATACCAAAACCGTTGATGTTCATATTCGTTGGTTACGCGAAAAATTAGAAACCGATCCCAGTCAACCAGAATATCTCATT
ACAGTACGAGGATTTGGCTATCGCTTCGGGTAA

Protein sequence :
MLSLDLAESSSLEKIVPNHRILVVEDEDVIRDMITIALEEQGYEVITASDGRTALNLLQDVATLGTESGFDLVVLDLMLP
QVNGLDICRLLRYNNNIVPILILSAKASETDRVLGLEVGADDYLTKPFSMRELVARCRALIRRQDFNNVSSAPVRKFKDI
SLYPEECRVVVRGEEINLSPKEYRLLELFMSYPRRVWSREQLIDQVWGADFLGDTKTVDVHIRWLREKLETDPSQPEYLI
TVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-42 45
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-47 44
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-45 44
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-42 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-37 42
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-32 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-32 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-32 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-32 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-32 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-32 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-32 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-32 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 8e-38 41
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-28 43
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-36 42
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-36 42
Cyan8802_2657 YP_003138353.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-38 41