Gene Information

Name : CAP2UW1_1996 (CAP2UW1_1996)
Accession : YP_003167221.1
Strain : Candidatus Accumulibacter phosphatis UW-1
Genome accession: NC_013194
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator PhoB
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2248464 - 2249189 bp
Length : 726 bp
Strand : +
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rfr:Rfer_0578 two component transcriptional regulator, winged helix family

DNA sequence :
ATGACCCGACCGGCTTCCAGTCTGCCGCAGGTCCTCGTCGTCGAGGACGACAAGGGCATTCAGGAACTGCTGCGCTTCAC
GCTCGTCTGCGGCGGCTATCAGCCGCTCTGCGTCGACACCGCCGAAGCGGCCGAGGCACTATTGCGCGAGACGCTGCCGG
ACCTGGCGCTGATCGACTGGATGCTTCCCGGCAAGTCCGGTCTGGCGCTCACCGGGCGCTTGCGCAGCGATGCGCGGACG
CGCCACCTGCCGATCATCCTGTTGACGGCGCGTGGCGAGGAGACTGATCGTGTCGCCGGCCTCGAAGGTGGCGCTGACGA
CTACATCGTCAAACCATTCAGCCCAAAGGAACTCGTCGCCCGCGTACACGCGGTGCTGCGCCGTTGTGCGCCCGAATTCG
TCAAGGGCACGCTGTGCGCCGGCCCGATCGAACTCGACACGGTCAGCCACGAAGCGCGCGTCGATGGTCAGCGAATCACT
CTGACGCCAACCGAGTTCCGCTTGCTGCGCTTCCTGATCGCCAACCCCGGGCGGGTCTACTCGCGCCAGCAGCTGCTCGA
CAACGTCTGGGGCGATCACGTCTATATCGAAGACCGTACGGTCGATATCCACATCCGGCGCCTGCGCGTCGCTCTCGGCC
CGGCAGCCGAGCAGATGGTCGAAACGGTGCGCGGGGTAGGCTACAAACTGATCGGGCGAGCCGAGTCGACGCAGAACGCC
CCATGA

Protein sequence :
MTRPASSLPQVLVVEDDKGIQELLRFTLVCGGYQPLCVDTAEAAEALLRETLPDLALIDWMLPGKSGLALTGRLRSDART
RHLPIILLTARGEETDRVAGLEGGADDYIVKPFSPKELVARVHAVLRRCAPEFVKGTLCAGPIELDTVSHEARVDGQRIT
LTPTEFRLLRFLIANPGRVYSRQQLLDNVWGDHVYIEDRTVDIHIRRLRVALGPAAEQMVETVRGVGYKLIGRAESTQNA
P

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB AE000516.2.gene3505. Protein 4e-31 44
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB BAC0039 Protein 7e-33 42
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB CP001918.1.gene3444. Protein 2e-32 42
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB BAC0596 Protein 2e-32 42
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB CP000034.1.gene2186. Protein 7e-33 42
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_002695.1.916589.p Protein 6e-33 42
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB CP001138.1.gene2239. Protein 2e-32 42
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB CP000647.1.gene2531. Protein 1e-32 42
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_002952.2859905.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_013450.8614421.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_007793.3914279.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_007622.3794472.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_002745.1124361.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_009782.5559369.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_002951.3237708.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_003923.1003749.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_002758.1121668.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_009641.5332272.p0 Protein 4e-35 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB CP001918.1.gene5135. Protein 9e-23 41
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB NC_002516.2.879194.p Protein 5e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB VFG0596 Protein 5e-26 42
CAP2UW1_1996 YP_003167221.1 winged helix family two component heavy metal response transcriptional regulator PhoB VFG1389 Protein 6e-24 42