Gene Information

Name : CAP2UW1_2981 (CAP2UW1_2981)
Accession : YP_003168188.1
Strain : Candidatus Accumulibacter phosphatis UW-1
Genome accession: NC_013194
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3434551 - 3435282 bp
Length : 732 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pol:Bpro_0543 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAACGAGCAACTGCTGCTCGTCGAGGACGACGACGCGATTGCCGCCGCCTTGCGTCTGCACCTGGAGGCGGCCGGCTA
CCGGCTGCATCGCGAGTCCGACGGCCTGCAGGCGATGGCGGCGATCGATCGCCAGCGCTGGGACATGGTCCTGCTTGACC
TCATGCTGCCGGGCGCCGACGGCTGGGACGTCTGCCGCCACCTGCGGGCACGTCACGCGGATGTGCCGGTGATCATGCTC
AGCGCCCGTTCGGCCGAGGCGCACCGTGTGCTGGGGCTCGAACTGGGCGCCGACGACTACCTCGCCAAGCCGTTCTCGAT
GCTCGAACTGGTGGCGCGCGTGCGCGCCCTGTTGCGGCGGATCGAGCAATTGCGCTCGTCGCCGGCGTTGGCGTCGGAAC
TGCGCTTCGGTCCTTTCCGGCTCGACACCGTCCGCCGCGAGCTTCTGCGCGGCGACGATGTCGTGCCGCTGACCCTGCGC
GAGTTCGATCTCCTGTACTTCCTGGCGCGCCACCCGGGCCGGGTGTTCAGCCGCGGCGAGCTGCTGCAGCGCGTCTGGGG
CGCCGCTTTCGACGGTTACGAGCACACCGTCAACTCGCACATCAACCGTCTGCGCACGAAGATCGAGGACGACCCGCGCG
ACCCGCGGCGGATCGTCACCGTCTGGGGCGTCGGCTACCGTTTCGAAGAGAAACCCGCATGCTCAGCCGCCGTTCCTTCA
CCACTCGCCTGA

Protein sequence :
MNEQLLLVEDDDAIAAALRLHLEAAGYRLHRESDGLQAMAAIDRQRWDMVLLDLMLPGADGWDVCRHLRARHADVPVIML
SARSAEAHRVLGLELGADDYLAKPFSMLELVARVRALLRRIEQLRSSPALASELRFGPFRLDTVRRELLRGDDVVPLTLR
EFDLLYFLARHPGRVFSRGELLQRVWGAAFDGYEHTVNSHINRLRTKIEDDPRDPRRIVTVWGVGYRFEEKPACSAAVPS
PLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-47 54
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-46 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-35 45
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 9e-34 45
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 4e-20 43
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-36 42
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 9e-22 42
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-31 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 8e-30 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 8e-30 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-26 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 3e-26 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-40 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-41 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-21 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 4e-22 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-21 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator BAC0533 Protein 4e-22 41
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-47 54
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-46 54
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-22 45
CAP2UW1_2981 YP_003168188.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-34 43