Gene Information

Name : Aaci_1114 (Aaci_1114)
Accession : YP_003184538.1
Strain : Alicyclobacillus acidocaldarius DSM 446
Genome accession: NC_013205
Putative virulence/resistance : Resistance
Product : heavy metal transport/detoxification protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1169852 - 1170058 bp
Length : 207 bp
Strand : +
Note : PFAM: Heavy metal transport/detoxification protein; KEGG: hiq:CGSHiGG_04270 mercuric ion scavenger protein

DNA sequence :
ATGACAACAGCAACCATCATCGTCAAAGGCATGACGTGCAGCGGTTGCGTAAACTCCGTCACCAAGGCGCTCAAAAACGT
GGAGGGTGTCCAGGAGGCGAGCGTGGATCTAGAAGGACAGAAAGCTACGGTCACCTTTGACGAGACGAAGACCAACTTGG
CCACGCTGAAAGAGGCCATCGAGGACGCCGGTTACGATACAGAGTGA

Protein sequence :
MTTATIIVKGMTCSGCVNSVTKALKNVEGVQEASVDLEGQKATVTFDETKTNLATLKEAIEDAGYDTE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AFG30122.1 MerP Not tested PAGI-2 Protein 6e-10 48
merP AGK07023.1 MerP Not tested SGI1 Protein 6e-10 48
merP AGK07081.1 MerP Not tested SGI1 Protein 6e-10 48
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 3e-10 48
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 9e-10 48
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 5e-10 48
merP ABQ57373.1 MerP Not tested SGI1 Protein 6e-10 48
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 6e-10 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aaci_1114 YP_003184538.1 heavy metal transport/detoxification protein BAC0231 Protein 2e-10 50
Aaci_1114 YP_003184538.1 heavy metal transport/detoxification protein BAC0678 Protein 3e-10 48
Aaci_1114 YP_003184538.1 heavy metal transport/detoxification protein BAC0674 Protein 1e-09 47
Aaci_1114 YP_003184538.1 heavy metal transport/detoxification protein BAC0679 Protein 7e-10 47
Aaci_1114 YP_003184538.1 heavy metal transport/detoxification protein BAC0675 Protein 3e-10 46
Aaci_1114 YP_003184538.1 heavy metal transport/detoxification protein BAC0634 Protein 2e-06 43