Gene Information

Name : Dtox_1077 (Dtox_1077)
Accession : YP_003190586.1
Strain : Desulfotomaculum acetoxidans DSM 771
Genome accession: NC_013216
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1103730 - 1104437 bp
Length : 708 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bha:BH3157 two-component response regulator involved in phosphate regulation

DNA sequence :
ATGCCAAGTGTTCTGGTAGTGGATGATGAGCAGAATATTATAGAAATCATCAAGTTTAATCTGGAACGGGAAGGCTACCA
AGTTATTACAGCCAGAGACGGTACAACAGCTCTACAACTGGCCCGCTCAGAAAAACCGGATCTGATTATACTGGATATAA
TGCTTCCTGAGCAGGATGGTTTAGCAGTGTGTCGCTTGCTGCAGCAGGAGCAAAAAACCAGAGGGATTCCCATTATTATG
GTCAGTGCAAGGGGAGATGAATTGGACAAAATTCTTGGGTTGGAAATGGGAGCGGATGATTATGTAACCAAACCTTTCAG
CCCTCGAGAACTGGTAGCCAGGGTTAAGGCCAGACTGAGGCGTAGTGAGGAAGTGGAAACAACGCCGGAAAAACCCGTTG
AAAATACTCTCGTGAGAGGGAATTTACTTATTGATCAGGATCGCTATATGATTGAGTTGGGTGGGGTAAAACAGTATTTA
ACCCCCAAGGAATTTGAATTAATCCGTTTTTTAGCCAGACAACCGGGAAAAGTATTCTCCCGTGATTATCTTTTGGAACA
AATCTGGGGTTATGATTTTGTGGGGGATTCTCGAACGGTTGATGTGCATATAAGACACATCAGGCAAAAACTAGAGGGAA
TGGATGCCTCCCAACAGTATATTGAAACGGTCAGGGGAGTAGGCTATCGCTTTAAAGAATCTTCTTAG

Protein sequence :
MPSVLVVDDEQNIIEIIKFNLEREGYQVITARDGTTALQLARSEKPDLIILDIMLPEQDGLAVCRLLQQEQKTRGIPIIM
VSARGDELDKILGLEMGADDYVTKPFSPRELVARVKARLRRSEEVETTPEKPVENTLVRGNLLIDQDRYMIELGGVKQYL
TPKEFELIRFLARQPGKVFSRDYLLEQIWGYDFVGDSRTVDVHIRHIRQKLEGMDASQQYIETVRGVGYRFKESS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-39 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-53 52
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-47 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 8e-49 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 7e-49 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 7e-49 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 7e-49 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 7e-49 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 7e-49 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 7e-49 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 7e-49 50
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-48 49
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-48 49
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-48 48
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-46 47
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-37 44
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family BAC0039 Protein 6e-40 43
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-39 43
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 6e-40 43
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family BAC0596 Protein 1e-39 43
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 7e-40 43
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 4e-34 42
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 3e-40 42
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-34 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-34 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-34 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-34 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-34 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-34 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-34 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-34 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 6e-37 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-38 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 8e-40 41
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 7e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family VFG1702 Protein 3e-39 42
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family VFG1389 Protein 3e-29 42
Dtox_1077 YP_003190586.1 two component transcriptional regulator, winged helix family VFG1563 Protein 7e-38 41