Gene Information

Name : Dtox_3055 (Dtox_3055)
Accession : YP_003192430.1
Strain : Desulfotomaculum acetoxidans DSM 771
Genome accession: NC_013216
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3252207 - 3252890 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bar:GBAA2212 DNA-binding response regulator

DNA sequence :
ATGTGTGATAAAAAAATCCTAATCATAGAAGATGAGGTGAAAATATCTAGATTTATCCAATTGGAGCTGGAGCATGAAGG
ATACATTGTAGAGAAGGAAAAGGACGGAAGAGCCGGTCTGGAAAAGGCTTTGCATGGCAATCATGATTTAATCATTCTTG
ATGTGATGCTTCCTTCACTGAATGGGATGGAAATATTGAGACGTTTGAGGCAAGTTTCCGAGATTCCGGTTATTATGCTC
ACTGCCAAAGATGATGTTATGGACAAAGTCATGGGGTTGGATTTTGGTGCTGATGATTATTTGACCAAACCTTTTGCCAT
TGAGGAGCTTCTGGCCAGGATTCGGGTAGCGTTTAAACATAAAAGGGTACAGCATGAAAAGTCCGATGTTATTCAGATCG
GAAACCTTAAACTTGATTTGTATAAATATACTGTCAGTTTTAATAATGAACCAATAGATTTAACAAAAAAGGAATTTGAT
TTGTTGAAACTTTTGATGGTTAATAATGAAATTGTACTTACCAGGGATACGATTCTGGAAAAAGTATGGGGATATAATTA
TGCCGGTGATACTAACATTGTGGATGTCTATGTCCGTTATCTCAGAATTAAAATTGACGACCGTTATCATCAAAAATTTA
TTCACACCGTCCGAGGGGTGGGATATCAGCTGAAAAATGGGTAA

Protein sequence :
MCDKKILIIEDEVKISRFIQLELEHEGYIVEKEKDGRAGLEKALHGNHDLIILDVMLPSLNGMEILRRLRQVSEIPVIML
TAKDDVMDKVMGLDFGADDYLTKPFAIEELLARIRVAFKHKRVQHEKSDVIQIGNLKLDLYKYTVSFNNEPIDLTKKEFD
LLKLLMVNNEIVLTRDTILEKVWGYNYAGDTNIVDVYVRYLRIKIDDRYHQKFIHTVRGVGYQLKNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-44 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-44 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 7e-49 53
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-50 52
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-50 52
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-50 52
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-50 52
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-50 52
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-50 52
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-50 52
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-50 52
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-46 50
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family BAC0308 Protein 6e-43 49
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family BAC0197 Protein 7e-45 48
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family BAC0125 Protein 4e-44 46
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-39 44
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family BAC0083 Protein 4e-45 44
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-38 44
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-43 43
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-38 43
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 4e-43 43
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-36 42
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 7e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 8e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 5e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 8e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 8e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 8e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 8e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 8e-36 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 8e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family VFG0596 Protein 4e-45 46
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-43 41
Dtox_3055 YP_003192430.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-38 41