Gene Information

Name : Dtox_3085 (Dtox_3085)
Accession : YP_003192460.1
Strain : Desulfotomaculum acetoxidans DSM 771
Genome accession: NC_013216
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3280758 - 3281456 bp
Length : 699 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bha:BH1580 two-component response regulator

DNA sequence :
GTGAGTAAAATAAAAATTATGGTGGCCGATGACGAAGAAAGAATCCGTCGTCTGGTAAAGATGTATCTGGAAAAGGAAGG
CTATGAAGTTGGCCAGGCAATAAACGGTGAGGATGTCCTGAAGCAGTTGGGACAGGATGCCTCTTGGGATTTATTGCTGT
TGGATTTAATGATGCCTGAAACTGACGGCTGGCAGGTTTGCCGGGAGCTTCGCAAAAAATCCGATATCCCGATAATTATG
TTGACGGCGCGAGGTGATGAAATTGACCGTGTATTGGGTCTGGAACTAGGCGCCGATGATTATGTGCTTAAGCCCTTTAG
TCCAAGAGAACTGGTAGCCAGGATTAAGGCTTTATTGAGAAGGGTTCGACGTAAGCAGGTTTATGGGGATGAAGTGCAGT
TGCAGTTTTCTGGATTAACCATTGATCCCGCTTCCAGAAAGGTTATCTTAATGGGACAGGTATTATCACTAACTCCCAAG
GAATTTGACCTGCTGTTATTTATGTCTCAATCGGCGGGACAAGTATTTTCCAGGGAGCAGCTGCTGCGGAATATATGGAA
CTATGATTATTTCGGCGATCCCCGTACGGTTGATACTCATATTAACCGTCTTAGAGATAAATTAACTAAAATTAAGGATG
CACCTCAGTATATTCATACAGTATGGGGTGTGGGATATAAATTTGAGGTTGCATTATGA

Protein sequence :
MSKIKIMVADDEERIRRLVKMYLEKEGYEVGQAINGEDVLKQLGQDASWDLLLLDLMMPETDGWQVCRELRKKSDIPIIM
LTARGDEIDRVLGLELGADDYVLKPFSPRELVARIKALLRRVRRKQVYGDEVQLQFSGLTIDPASRKVILMGQVLSLTPK
EFDLLLFMSQSAGQVFSREQLLRNIWNYDYFGDPRTVDTHINRLRDKLTKIKDAPQYIHTVWGVGYKFEVAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-43 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-42 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 6e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-49 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 8e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 7e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 8e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 6e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 8e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 8e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 8e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-49 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 8e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 8e-50 49
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 3e-39 46
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 5e-40 46
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 5e-40 46
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 8e-37 46
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-46 45
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 5e-40 45
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 6e-41 45
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family BAC0596 Protein 1e-39 45
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family BAC0039 Protein 9e-41 45
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-39 45
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 9e-41 45
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 3e-46 44
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 6e-47 44
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 9e-40 44
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 3e-29 44
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 2e-31 43
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family BAC0533 Protein 8e-32 43
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 2e-31 43
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 8e-32 43
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 2e-31 43
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-38 43
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 1e-42 42
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 2e-41 42
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 1e-42 42
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 1e-43 42
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 1e-38 42
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 7e-43 41
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 3e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family VFG1563 Protein 7e-44 44
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family VFG1702 Protein 6e-43 44
Dtox_3085 YP_003192460.1 two component transcriptional regulator, winged helix family VFG1389 Protein 3e-31 41