Gene Information

Name : Namu_1193 (Namu_1193)
Accession : YP_003200589.1
Strain : Nakamurella multipartita DSM 44233
Genome accession: NC_013235
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1311768 - 1312490 bp
Length : 723 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sml:Smlt0594 two-component response regulator transcriptional regulatory protein

DNA sequence :
ATGGACCCGTCACGGGTGCTCGTCGTCGACGACGACGACACCGTCCGCGAGGTCCTGCGCCGCTACCTGACCCGGGACGG
TCACGACGTGCTGGAGGCGGCGGACGGGCCGACCGGCCTGCGGCTGGTGCGCAGCCACCACCCCGACCTGATCGTGCTCG
ACCTGATGCTGCCGGGCATGGACGGATTGCAGGTCTGCCGCGAGGTCCGCCGCACCTCCACCGTGCCGGTGATCATGCTC
ACCGCTCTGGGCCAGGAATCGGACCGGGTGGTCGGCCTGGAGTTCGGCGCCGACGACTACGTGGTCAAGCCGTTCAGCCC
GCGCGAGCTGGCCCTGCGGGTGTCCCGGGTGCTGCAACGCAGCCGCGGCCCGGCCGCCCCGGCCGCGCCGGGCAGCGCCG
AGGTGACCAGTGCCGACGGGGAACTGTCGGCGAACGCGTTGTCCCGCACCGCCCGTCGCGGCGGCGACGAGCTGGCCCTG
ACCAGCCGGGAGTTCGACCTGCTGCACTTCCTGTTGGCCCACCCCGGACAGGTGTTCAGCCGGACCGAGCTGATGGAGCA
GGTCTGGGGCTGGTCGTTCGGCGACCAGTCGACGGTGACGGTGCACGTGCGCCGGCTGCGGGAGAAGGTCGAACCCGACC
CGACCAAGCCGACCCGGATCGTGACCGTCTGGGGCGTGGGCTACCGGCTCGACGGCGACCTGCGCCCGGCCGACCCGGGC
TGA

Protein sequence :
MDPSRVLVVDDDDTVREVLRRYLTRDGHDVLEAADGPTGLRLVRSHHPDLIVLDLMLPGMDGLQVCREVRRTSTVPVIML
TALGQESDRVVGLEFGADDYVVKPFSPRELALRVSRVLQRSRGPAAPAAPGSAEVTSADGELSANALSRTARRGGDELAL
TSREFDLLHFLLAHPGQVFSRTELMEQVWGWSFGDQSTVTVHVRRLREKVEPDPTKPTRIVTVWGVGYRLDGDLRPADPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-26 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-33 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-42 47
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-39 43
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-33 43
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-35 43
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-30 42
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-29 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-37 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-35 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-26 42
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-33 42
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-33 41
Namu_1193 YP_003200589.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-25 41