Gene Information

Name : Namu_3014 (Namu_3014)
Accession : YP_003202340.1
Strain : Nakamurella multipartita DSM 44233
Genome accession: NC_013235
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3303901 - 3304476 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: noc:Noc_1002 stress protein

DNA sequence :
ATGGGTGTGAGCCTGACCAAGGGCGGCAACGTCTCGCTGACGAAGGCCGCTCCCGGCCTGAAGGCAGTGGCCGTCGGCCT
GGGCTGGGACGTCCGATCCACCACCGGTGACGATTTCGACCTGGACGCGAGCGCGTTGGGCCTGGATCCGAACCACCGGG
TGGTCTCCGACGAGTACTTCATCTTCTTCAACAACAAGACCTCGCCCGACGGGTCGATCGTGCATCAGGGCGATAACCTG
ACCGGTGAGGGCGAGGGCGACGACGAGGTCATCAACGTGGACCTGTCGACCGTGCCGGCCACCGTGGATTCCATCGTCTT
CCCGGTCTCGATCTACGACGCGGATACCCGCGGGCAGTCCTTCGGCCAGGTCCGCAACGCCTTCATCCGGGTCGTGGACC
AGTCCAACGGCAGCGAACTGGCCCGCTACGACCTGTCCGAGGACGCGTCGACCGAGACCGCCATGGTGTTCGGTGAGCTG
TATCGCAACGGCGCGGAGTGGAAGTTCCGCGCAATCGGTCAGGGCTACGCTTCGGGGCTGGCGGGGATTGCCCGCGACTT
CGGAGTGAACATCTGA

Protein sequence :
MGVSLTKGGNVSLTKAAPGLKAVAVGLGWDVRSTTGDDFDLDASALGLDPNHRVVSDEYFIFFNNKTSPDGSIVHQGDNL
TGEGEGDDEVINVDLSTVPATVDSIVFPVSIYDADTRGQSFGQVRNAFIRVVDQSNGSELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLAGIARDFGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-56 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-56 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-56 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 62
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-57 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-52 62
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-55 61
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 8e-33 46
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-29 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-29 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Namu_3014 YP_003202340.1 stress protein BAC0390 Protein 6e-57 63
Namu_3014 YP_003202340.1 stress protein BAC0389 Protein 1e-55 63
Namu_3014 YP_003202340.1 stress protein BAC0392 Protein 3e-29 45