Gene Information

Name : Namu_4688 (Namu_4688)
Accession : YP_003203954.1
Strain : Nakamurella multipartita DSM 44233
Genome accession: NC_013235
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5211643 - 5212401 bp
Length : 759 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 transcriptional regulator

DNA sequence :
ATGACCGCACCGAGCCCGCTGTCCAGCACCGCCGTCCCGGCCGACCGCGCCGCCCTGCGCGGTCCGGACGGGCGGCCCAT
CCGCGTCCTGGTCGTCGACGACGAGCAGTCGCTCTCGGAGCTGGTCAGCCTGGCCCTGCGGTACGAGGGCTGGGAGGTGC
GCTCGGCGCCGGACGGCCTGTCCGCGATCGCCGCCGCCCGTGACTTCCGGCCCGACCTGGTCGTGCTGGACGTCATGCTG
CCCGACATCGACGGACTGGAGGTGCTGCGCCGGCTGCGCGCGGACATCGAGCGCATGCCGGTGCTGTTCCTGACCGCGAA
GGACGACGTCAGCGACCGCATCGCCGGCCTGACCGCGGGCGGCGACGACTACGTCACCAAGCCGTTCTCCATCGAGGAGC
TGGTGCTGCGGCTGCGGGCCCTGCTGCGCCGCTCCCACCTGGCCCTGACCACCGACTCGTCCACCATCGTGGTCGGCGAC
CTGGTGCTGGACGAGGATTCCCGCGAGGTCCGCCGGGGTGACGACCTGATCAGCCTGACCGCGACCGAGTTCGAACTGCT
GCGATTCCTCATGCGCAACCCCAAGCGGGTCATGTCCAAGGCGCAGATCCTGGATCGGGTCTGGAACTACGACTTCGGCG
GCCAGGCCAATATCGTGGAGCTCTACATTTCCTACCTGCGCAAGAAGATCGACGCCGGACGGGAACCGATGATCCACACC
ATGAGGGGTTTCGGTTATGTCCTCAAGCCCGCCACCTGA

Protein sequence :
MTAPSPLSSTAVPADRAALRGPDGRPIRVLVVDDEQSLSELVSLALRYEGWEVRSAPDGLSAIAAARDFRPDLVVLDVML
PDIDGLEVLRRLRADIERMPVLFLTAKDDVSDRIAGLTAGGDDYVTKPFSIEELVLRLRALLRRSHLALTTDSSTIVVGD
LVLDEDSREVRRGDDLISLTATEFELLRFLMRNPKRVMSKAQILDRVWNYDFGGQANIVELYISYLRKKIDAGREPMIHT
MRGFGYVLKPAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 3e-25 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 3e-25 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 3e-25 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 3e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-30 44
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-36 44
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-30 43
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-29 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-33 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-35 42
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-33 41
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-33 41
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-33 41
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-33 41
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-33 41
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-33 41
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-33 41
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-33 41
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-51 50
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-45 49
Namu_4688 YP_003203954.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-36 46