Gene Information

Name : phoB (DAMO_1129)
Accession : YP_003206026.1
Strain : Candidatus Methylomirabilis oxyfera
Genome accession: NC_013260
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family)
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 954024 - 954707 bp
Length : 684 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type r : regulator

DNA sequence :
ATGAAAGTCTTGGTCGTGGACGATGAGAAAGACATTACCGCCCTGGTCGCCTATCATCTTGAGCGCGAGGGATTTCGTGT
CCTCCAGGCCCATGATGGCCTTCAGGCCTTGGAGCTGGTCAAGCGTGAGCGACCGAGCCTGCTGGTCCTGGATCTGATGC
TGCCGCATCTGAGCGGGTTGGATGTCTGCCGTCGGCTCCGCAAAGAACCCGATACCGCGCGCCTACCGATCCTGATGCTG
ACCGCCAAGGCGGAAGAAACTGACAAGGTCCTAGGTCTTGAACTGGGCGGCGACGACTATCTCACCAAGCCGTTCGGACC
CAAGGAGCTGGTGGCCAGGGTCAAGGCCCTGATTCGCAGAAGCGAAGAGGTCCAGGGTGGAGAGATTGTGAAGGCCGGCA
GCCTTGAGATCGATCTCGACCGGTATACTGTTGCGATTCGCAAGCGGGCCGTCGAGCTGACACCGAAGGAATTCGACCTT
TTGAAGGCCCTCGTTCTGGCCAAGGGCCGTGTCCTGACCAGGGAATACCTGTTGGACCGTGTCTGGGGATACGAGCGAGC
CTCCGAGATAGAATCCCGCACCGTCGATGTCCATGTCCGGCGCCTCCGGGAGAAGCTGGGGCCGGAGGCTGCGCGCATCG
TCACCGTCAAGAGCGTCGGGTACCGGTTCAATCAGGACTCCTGA

Protein sequence :
MKVLVVDDEKDITALVAYHLEREGFRVLQAHDGLQALELVKRERPSLLVLDLMLPHLSGLDVCRRLRKEPDTARLPILML
TAKAEETDKVLGLELGGDDYLTKPFGPKELVARVKALIRRSEEVQGGEIVKAGSLEIDLDRYTVAIRKRAVELTPKEFDL
LKALVLAKGRVLTREYLLDRVWGYERASEIESRTVDVHVRRLREKLGPEAARIVTVKSVGYRFNQDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_002952.2859905.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_009782.5559369.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_002951.3237708.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_003923.1003749.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_002758.1121668.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_007622.3794472.p0 Protein 9e-47 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_009641.5332272.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_013450.8614421.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_007793.3914279.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_002745.1124361.p0 Protein 1e-46 50
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_012469.1.7685629. Protein 6e-45 48
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) AE000516.2.gene3505. Protein 9e-38 46
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_012469.1.7686381. Protein 4e-44 45
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) HE999704.1.gene2815. Protein 1e-45 45
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) AE016830.1.gene1681. Protein 2e-47 45
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) AF162694.1.orf4.gene Protein 5e-30 42
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) FJ349556.1.orf0.gene Protein 1e-34 41
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) CP001918.1.gene5135. Protein 8e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) VFG1702 Protein 6e-39 41
phoB YP_003206026.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) VFG1389 Protein 3e-27 41