Gene Information

Name : phoB (DAMO_2818)
Accession : YP_003207690.1
Strain : Candidatus Methylomirabilis oxyfera
Genome accession: NC_013260
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family)
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2422878 - 2423618 bp
Length : 741 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type r : regulator

DNA sequence :
ATGATTCACAATGCTCCCACGGTATTGCTGATCGAAGACGATGCCTCGATCGCCGAACCGTTAATCTTCGGATTGCGAAG
AGAGGGATTTCATGTCCTGCATGCCGGTGATGGGCTCCAGGGCAAAGCGCTGGCTTTGACAGCGAAACCTGACGTGGTGC
TGCTCGATATCATGTTGCCGAAGCTGAGCGGCTTGGAGGTGTGTGAGCTGATCCGTCGAGAATCCGTCGTCCCGATCGTG
ATGCTGACCGCTAAAGGGCAGGAGTTGGATCGGGTCAGGGGGTTACAGGGCGGGGCCGATGATTACATCGTTAAGCCGTT
CAGTTTCCAGGAACTGGTTGCGCGCATCCAGGCGATCCTACGACGTCGCCAGCTGGATCGGGGCGATGCCCTCCCATCCG
GGGACCGCGACCGCATAGCGATCACGTCGATCGTGATCGACCGCGTGGCGCGCGAGGTGTGGCGGAAGAAGAAAAAGCTC
GAGTTGAGTTGGCGGGAGTTCGAGTTGTTATGGCTCCTGATGGAGCACGTCGGCAAGGCGCTCTCGCGTCATGAGATCCT
GGATCGGATTTGGGGGGAAGATTGGGTTGGGGACCCGAAGACCCTCGATGTCTATATTCGATGGCTGCGGGAAAAGATTG
AGAAGAATCCGTCGGCGCCAGAGTACATCCAGACTGTGAGGGGCTATGGGTACCGATTTACCGATCCTCAGACGCCTGAA
AACGAGCGGTCGCGTCAATAG

Protein sequence :
MIHNAPTVLLIEDDASIAEPLIFGLRREGFHVLHAGDGLQGKALALTAKPDVVLLDIMLPKLSGLEVCELIRRESVVPIV
MLTAKGQELDRVRGLQGGADDYIVKPFSFQELVARIQAILRRRQLDRGDALPSGDRDRIAITSIVIDRVAREVWRKKKKL
ELSWREFELLWLLMEHVGKALSRHEILDRIWGEDWVGDPKTLDVYIRWLREKIEKNPSAPEYIQTVRGYGYRFTDPQTPE
NERSRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_012469.1.7686381. Protein 6e-42 45
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) HE999704.1.gene2815. Protein 6e-45 45
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_012469.1.7685629. Protein 6e-42 44
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_002952.2859905.p0 Protein 9e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_013450.8614421.p0 Protein 7e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_007793.3914279.p0 Protein 7e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_002745.1124361.p0 Protein 7e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_009782.5559369.p0 Protein 7e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_002951.3237708.p0 Protein 7e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_007622.3794472.p0 Protein 1e-40 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_003923.1003749.p0 Protein 6e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_002758.1121668.p0 Protein 7e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) NC_009641.5332272.p0 Protein 7e-41 43
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) BAC0125 Protein 2e-32 42
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) AE000516.2.gene3505. Protein 4e-34 42
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) AE016830.1.gene1681. Protein 1e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_003207690.1 response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) VFG1563 Protein 1e-35 41