Gene Information

Name : ECO103_3577 (ECO103_3577)
Accession : YP_003223438.1
Strain : Escherichia coli 12009
Genome accession: NC_013353
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3659558 - 3659764 bp
Length : 207 bp
Strand : +
Note : Integrative element ECO103_IE03

DNA sequence :
ATGAATACCCCGGTTTCGCTGATGGATGACCAGCTGGTCGACATGGCATTTATCACTCAACTGACCGGCTTAACCGATAA
GTGGTTTTATAAGCTCATCAGAGATGGTGCCTTTCCGGCCCCTATCAAAATGGGTCGCAGCTCCCGCTGGCTGAAAAGCG
AAGTGGAAGCCTGGCTGCAGGCACGCATTGCACAGTCCCGTCCGTAG

Protein sequence :
MNTPVSLMDDQLVDMAFITQLTGLTDKWFYKLIRDGAFPAPIKMGRSSRWLKSEVEAWLQARIAQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 8e-27 100
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 5e-26 95
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 1e-25 95
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 1e-25 95
unnamed AAL08466.1 unknown Not tested SRL Protein 9e-26 93
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-25 92
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-25 92
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-25 92
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 1e-14 70
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 1e-14 70
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-17 70
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 7e-18 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECO103_3577 YP_003223438.1 transcriptional regulator VFG1057 Protein 4e-26 93
ECO103_3577 YP_003223438.1 transcriptional regulator VFG0651 Protein 4e-26 92
ECO103_3577 YP_003223438.1 transcriptional regulator VFG1480 Protein 3e-18 70