Gene Information

Name : ler (ECO103_3638)
Accession : YP_003223495.1
Strain : Escherichia coli 12009
Genome accession: NC_013353
Putative virulence/resistance : Virulence
Product : transcription regulator Ler
Function : -
COG functional category : R : General function prediction only
COG ID : COG2916
EC number : -
Position : 3709699 - 3710088 bp
Length : 390 bp
Strand : -
Note : Integrative element ECO103_IE03

DNA sequence :
ATGCGGAGATTATTTATTATGAATATGGAAACTAATTCGCACACAACAAGCCCATACATTCAGCTTATTGAGCAAATTGA
AGTGTTACAACAGGAAGCAAAGCGACTGCGAGAGCAGGAAATTCAAAGTGTAATTGAGTCGATTCAAAAGCAGATTACTT
ATTACAATATAACCCTACAAGAGCTGGGATATACTAATGTGCCTGATGATGGCCTTGCTCGCCGGAACTCATCGAAAGGA
GTTTATTATCGCAATGAAGAAGGGCAGACCTGGTCGGGAGTTGGCCGACAGCCACGCTGGCTTAAAGAAGCACTGTTGAA
TGGAATGAAGAAAGAAGATTTTCTTGTGAAGGACACCGAAGACGAAATAATACCGCTGAAAAATATTTAA

Protein sequence :
MRRLFIMNMETNSHTTSPYIQLIEQIEVLQQEAKRLREQEIQSVIESIQKQITYYNITLQELGYTNVPDDGLARRNSSKG
VYYRNEEGQTWSGVGRQPRWLKEALLNGMKKEDFLVKDTEDEIIPLKNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ler YP_003223495.1 transcription regulator Ler Not tested LEE Protein 7e-49 100
ler AAK26696.1 Ler Virulence LEE Protein 5e-49 100
ler YP_003232133.1 transcriptional regulator Ler Not tested LEE Protein 7e-49 100
ler AAL57523.1 Ler Virulence LEE Protein 5e-49 100
ler AAL57584.1 Ler Virulence LEE Protein 5e-49 100
ler CAC81843.1 Ler protein Not tested LEE II Protein 5e-49 100
ler CAI43893.1 LEE encoded regulator Virulence LEE Protein 3e-40 100
ler YP_003236108.1 transcriptional regulator Ler Not tested LEE Protein 7e-49 98
unnamed AAC38364.1 Orf1 Virulence LEE Protein 5e-49 98
Z5140 NP_290288.1 hypothetical protein Not tested LEE Protein 1e-48 97
ECs4588 NP_312615.1 hypothetical protein Virulence LEE Protein 1e-48 97
unnamed AAC31533.1 L0054 Not tested LEE Protein 9e-49 97
ler ACU09478.1 transcription regulator Ler Not tested LEE Protein 9e-49 97
unnamed AAL06349.1 LEE-encoded regulator Virulence LEE Protein 4e-45 90
ler AFO66332.1 locus of enterocyte effacement-encoded regulator Virulence SESS LEE Protein 3e-30 68
ler AFO66395.1 locus of enterocyte effacement (LEE)-encoded regulator Virulence SESS LEE Protein 3e-30 68

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ler YP_003223495.1 transcription regulator Ler VFG0710 Protein 2e-49 98
ler YP_003223495.1 transcription regulator Ler VFG0832 Protein 4e-49 97