Gene Information

Name : yedW (ECO111_2548)
Accession : YP_003234961.1
Strain : Escherichia coli 11128
Genome accession: NC_013364
Putative virulence/resistance : Virulence
Product : putative DNA-binding response regulator in two-component system with YedV
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2530111 - 2530782 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
ATGAAGATTTTACTTATTGAAGATAATCAAAGGACCCAGGAGTGGGTAACGCAGGGGCTTTCCGAAGCGGGTTATGTCAT
TGATGCCGTTTCTGATGGCAGAGATGGGCTTTATCTTGCGCTGAAGGATGATTATGCATTGATCATTCTGGATATTATGC
TTCCGGGTATGGATGGCTGGCAGATCTTACAAACGTTAAGAACAGCAAAGCAAACCCCTGTTATTTGCCTTACTGCAAGG
GATTCTGTCGATGACAGAGTCAGAGGGCTGGACAGTGGAGCAAATGATTATCTGGTAAAACCTTTTTCATTTTCTGAGTT
GCTGGCAAGGGTTCGGGCACAATTAAGGCAACATCACGCTTTGAATTCAACATTAGAAATCAGTGGCTTAAGAATGGACT
CTGTTAGTCAAAGTGTGAGCAGGGACAATATCAGTATTACACTGACGCGCAAGGAGTTTCAGTTACTTTGGCTACTGGCC
TCCAGAGCTGGCGAAATTATACCCAGAACGGTTATTGCGAGTGAAATTTGGGGAATCAACTTTGATAGTGATACCAATAC
GGTGGATGTCGCCATTCGCAGGCTCCGCGCAAAAGTTGATGATCCTTTTCCTGAAAAGCTAATCGCCACAATCCGGGGGA
TGGGCTATTCATTCGTAGCGGTAAAAAAATAA

Protein sequence :
MKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTAR
DSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNSTLEISGLRMDSVSQSVSRDNISITLTRKEFQLLWLLA
SRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPFPEKLIATIRGMGYSFVAVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-80 77
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-80 76

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV BAC0125 Protein 8e-59 57
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV BAC0197 Protein 4e-56 56
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV BAC0083 Protein 4e-54 54
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV BAC0308 Protein 3e-52 53
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV BAC0111 Protein 9e-56 52
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV BAC0638 Protein 6e-49 52
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV BAC0347 Protein 3e-50 49
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV NC_003923.1003417.p0 Protein 2e-38 42
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV NC_013450.8614146.p0 Protein 2e-38 42
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV NC_002951.3238224.p0 Protein 2e-38 42
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV NC_007793.3914065.p0 Protein 2e-38 42
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV NC_002758.1121390.p0 Protein 2e-38 42
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV NC_010079.5776364.p0 Protein 2e-38 42
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV NC_002952.2859858.p0 Protein 2e-38 42
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV NC_007622.3794948.p0 Protein 2e-38 42
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV AE015929.1.gene1106. Protein 2e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_003234961.1 putative DNA-binding response regulator in two-component system with YedV VFG0596 Protein 5e-81 77