Gene Information

Name : cusR (ECO111_0598)
Accession : YP_003233121.1
Strain : Escherichia coli 11128
Genome accession: NC_013364
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator CusR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 641962 - 642645 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAAACTGTTGATTGTCGAAGATGAAAAGAAAACCGGAGAATACTTGACCAAAGGGTTAACCGAAGCCGGTTTTGTGGT
CGATTTGGCCGACAACGGGCTGAATGGCTACCATCTGGCGATGACCGGTGATTATGATCTGATAATCCTCGATATTATGC
TGCCGGACGTGAACGGCTGGGATATCGTGCGCATGTTGCGTTCCGCCAATAAAGGGATGCCGATTCTGTTGCTTACCGCG
CTTGGCACCATTGAACATCGCGTCAAGGGGCTGGAGTTGGGGGCAGATGACTACCAGGTGAAACCATTCGCTTTTGCTGA
ACTGCTGGCGCGGGTGCGCACTCTCCTGCGGCGCGGGGCGGCGGTGATTATCGAAAGTCAGTTTCAGGTTGCCGATCTGA
TGGTCGATCTCGTCAGCCGCAAAGTCACCCGCAGCGGCACGCGCATCACTCTGACCAGTAAAGAGTTTACTCTGCTGGAG
TTTTTCCTCCGCCATCAGGGCGAAGTGCTGCCCCGCTCGCTTATCGCCTCGCAGGTGTGGGACATGAATTTCGACAGCGA
CACTAACGCCATTGATGTAGCGGTGAAGCGGCTGCGCGGCAAAATCGACAACGACTTTGAGCCAAAGCTAATTCAGACCG
TGCGCGGCGTGGGTTACATGCTTGAGGTGCCGGATGGTCAGTAA

Protein sequence :
MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTA
LGTIEHRVKGLELGADDYQVKPFAFAELLARVRTLLRRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLE
FFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLEVPDGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-55 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_003233121.1 DNA-binding response regulator CusR BAC0111 Protein 2e-103 99
cusR YP_003233121.1 DNA-binding response regulator CusR BAC0347 Protein 1e-86 82
cusR YP_003233121.1 DNA-binding response regulator CusR BAC0083 Protein 7e-70 61
cusR YP_003233121.1 DNA-binding response regulator CusR BAC0638 Protein 1e-62 61
cusR YP_003233121.1 DNA-binding response regulator CusR BAC0308 Protein 6e-63 60
cusR YP_003233121.1 DNA-binding response regulator CusR BAC0197 Protein 2e-63 59
cusR YP_003233121.1 DNA-binding response regulator CusR BAC0125 Protein 5e-63 56
cusR YP_003233121.1 DNA-binding response regulator CusR AE000516.2.gene3505. Protein 8e-27 42
cusR YP_003233121.1 DNA-binding response regulator CusR NC_007793.3914065.p0 Protein 6e-34 41
cusR YP_003233121.1 DNA-binding response regulator CusR NC_002758.1121390.p0 Protein 6e-34 41
cusR YP_003233121.1 DNA-binding response regulator CusR NC_010079.5776364.p0 Protein 6e-34 41
cusR YP_003233121.1 DNA-binding response regulator CusR NC_002952.2859858.p0 Protein 6e-34 41
cusR YP_003233121.1 DNA-binding response regulator CusR NC_007622.3794948.p0 Protein 6e-34 41
cusR YP_003233121.1 DNA-binding response regulator CusR NC_003923.1003417.p0 Protein 6e-34 41
cusR YP_003233121.1 DNA-binding response regulator CusR NC_013450.8614146.p0 Protein 6e-34 41
cusR YP_003233121.1 DNA-binding response regulator CusR NC_002951.3238224.p0 Protein 6e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_003233121.1 DNA-binding response regulator CusR VFG0596 Protein 8e-56 52
cusR YP_003233121.1 DNA-binding response regulator CusR VFG1390 Protein 2e-42 43