Gene Information

Name : Adeg_1011 (Adeg_1011)
Accession : YP_003238994.1
Strain : Ammonifex degensii KC4
Genome accession: NC_013385
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1027299 - 1027994 bp
Length : 696 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: tbd:Tbd_0216 two component transcriptional regulator

DNA sequence :
TTGCCGCTGGTGCTGGTAGTTGACGACGAGGAGCACATCCAAAAACTTTTGCACTTCACCCTATCCAAGGAGGGCTTTCA
AGTTCTGGTAGCCGCTGACGGTCCGCAGGCTTTGGAGATGGCCAGGCAGCACCGGCCGGACGTCATCATCCTCGATCTCA
TGCTGCCGGCCCTCGACGGGTTTACAGTTTGCGAACTTTTGCGCCGAGATCCCAGCTTGAAAGAGATACCCGTAATTGTA
CTTAGTGCGCGGGGAACGGAGGAGGACAAGGTGCGGGGCTTGGATATCGGCGCTGACGATTATGTCACCAAGCCGTTTAG
TCCCCGCGAACTGGCGGCGCGGGTGAAGGCCCAGCTGAGAAGACGTCAGAGCCAAGCTGAGCGGGAAAAGCTGGTGTACG
GCCCGCTGGTGATCGACCGGGAGCGCTACGCCGTGGCCTGGAAAGAACACTGGCAGTACCTCGCCCCGAAAGAGTTTGAG
CTCTTGTACTTCTTGGCCACCCATCCTGGAAGGGTTTTCAGCCGGGAACAATTGCTAGATCAGATTTGGGGTTACGATTA
CCTGGGAGGACCTCGCACCGTGGACGTACACGTGCGCTATATCCGGCAGAAACTGGAGCAGATGCCGGGCGCACCGCAGC
TCATAGAAACCGTCCGAGGAGTCGGATACCGCTTCCGGGAGCCAGCCCAATGGTAG

Protein sequence :
MPLVLVVDDEEHIQKLLHFTLSKEGFQVLVAADGPQALEMARQHRPDVIILDLMLPALDGFTVCELLRRDPSLKEIPVIV
LSARGTEEDKVRGLDIGADDYVTKPFSPRELAARVKAQLRRRQSQAEREKLVYGPLVIDRERYAVAWKEHWQYLAPKEFE
LLYFLATHPGRVFSREQLLDQIWGYDYLGGPRTVDVHVRYIRQKLEQMPGAPQLIETVRGVGYRFREPAQW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-46 49
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-50 49
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-46 48
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-45 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-49 46
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 2e-42 44
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-40 44
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 9e-39 43
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family BAC0596 Protein 3e-37 43
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family BAC0039 Protein 1e-38 43
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 9e-39 43
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 3e-37 43
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 1e-38 43
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 6e-42 42
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 6e-39 42
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family BAC0125 Protein 9e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family VFG1389 Protein 3e-37 47
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family VFG1563 Protein 4e-36 43
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family VFG1386 Protein 6e-40 43
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-36 42
Adeg_1011 YP_003238994.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-41 41