Gene Information

Name : Adeg_1028 (Adeg_1028)
Accession : YP_003239011.1
Strain : Ammonifex degensii KC4
Genome accession: NC_013385
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1046928 - 1047641 bp
Length : 714 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: vap:Vapar_2988 two component transcriptional regulator, winged helix family

DNA sequence :
GTGCAAGCCAAGACCGAACCCGCCCGCATATTGATAGTCGACGACGAGCACCGGATAAGAGAGGTACTGCGGAAGTACCT
CGTGGCGGAAGGCTTCGGAGTCGGCGAGGCGGCCGATGGTGAAGCAGCACTGGCAGAGATCCGCTCGGGCCACTGGGACC
TCGTCATCCTGGACATAATGTTGCCTAAAATCGACGGCTGGGAGGTCTGCCGGGAGATCCGGAAAATTTCCGATGTGCCG
ATACTCATGCTCACCGCCCGGGGTGATGAAATCGACCGCGTGCTCGGTTTGGAGCTCGGGGCCGACGACTACATCGTAAA
GCCGTTCAGCCCCCGGGAGGTCGTGGCGCGGGTGAAGGCGGTGCTGCGCCGGGCCAGAAAAAGCTCCACACCGGGGAAGC
AAATCGTTTTGGGCAACGTAGTAATCGAACCGGAAGCGCGCACGGTAACGGTAGGCGGAAAAACCCTAGCTCTCACTCCG
AAGGAGTTCGACCTTCTTCTCACCCTCGCCAGGTCACCCGGGAAGGTCTTCCGCCGAGAGGAGCTTCTGGATCTGGTCTG
GGGGTACGATTTTTACGGGGATTCCCGCACAGTAGACACCCACGTCGCCCGCCTCCGGGAGAAACTCAATCAGGCAGGGG
CGCCCCCGCTCATCGCCACTGTCTGGGGCGTGGGCTACAAGCTAGAGGTGCGGAATGCGGAGCATAGCAGCTAA

Protein sequence :
MQAKTEPARILIVDDEHRIREVLRKYLVAEGFGVGEAADGEAALAEIRSGHWDLVILDIMLPKIDGWEVCREIRKISDVP
ILMLTARGDEIDRVLGLELGADDYIVKPFSPREVVARVKAVLRRARKSSTPGKQIVLGNVVIEPEARTVTVGGKTLALTP
KEFDLLLTLARSPGKVFRREELLDLVWGYDFYGDSRTVDTHVARLREKLNQAGAPPLIATVWGVGYKLEVRNAEHSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-34 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-34 45
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 6e-23 43
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 2e-22 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 2e-22 42
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 2e-22 42
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 2e-22 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-25 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-40 51
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-40 51
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-40 51
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-40 51
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-40 51
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-40 51
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-40 51
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-40 51
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-40 50
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-40 50
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 7e-37 49
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-37 47
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 7e-35 47
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-36 47
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family BAC0039 Protein 5e-34 46
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family BAC0596 Protein 1e-33 46
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 5e-34 46
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 4e-34 46
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-33 46
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 2e-34 45
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 5e-32 45
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 9e-27 45
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-27 44
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 6e-32 44
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 1e-31 44
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 5e-32 44
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 4e-33 44
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-31 44
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 4e-33 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-29 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-29 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-29 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-29 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-29 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-29 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-29 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-29 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 3e-21 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-29 42
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family BAC0308 Protein 8e-28 42
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 2e-28 42
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 4e-29 42
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-34 42
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_009085.4919120.p0 Protein 2e-25 42
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-33 42
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 1e-30 41
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 1e-30 41
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 1e-28 41
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 1e-27 41
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 8e-27 41
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 1e-27 41
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-26 47
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family VFG1563 Protein 1e-34 46
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-34 45
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family VFG1386 Protein 2e-23 43
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-31 42
Adeg_1028 YP_003239011.1 two component transcriptional regulator, winged helix family VFG0596 Protein 5e-26 41