Gene Information

Name : Adeg_0644 (Adeg_0644)
Accession : YP_003238641.1
Strain : Ammonifex degensii KC4
Genome accession: NC_013385
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 664113 - 664823 bp
Length : 711 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: glo:Glov_0588 two component transcriptional regulator, winged helix family

DNA sequence :
GTGGTGACCAGGGAAGGAGCAGCTACCGTGCTGGTGGTGGAAGACGATCGCAATATTGCTGAACTAGTGAGCCTTTACCT
TGAGAAGCATGGTTTCAAAGTGCTTAAGGCGGCGAGCGGTGCGGAGGCGCTGGAGATTCTGAAAAACGAAACCGTTGATC
TGGTCGTTCTCGATCTCATGTTACCCGGGATCGACGGCTGGGAAGTCTGCCGTCAGATCCGTTCGAACTCCCAGCTGCCG
GTAATAATGCTCACTGCTAAAGGGGAGCTCCAGGACAAGCTGCAGGGCTTTGAGTTGGGGGCGGACGATTACGTGGTCAA
GCCTTTCGACCCCCAGGAGCTAATAGCCCGGGTGAAGGCGGTGCTGCGCCGGGCCGGAGAAACCAAGCCCAGGCGGGTGG
ACCTTCCCGACCTCACGATTGATCTGGAAAGCTACGTGGTGGAAGTGGCGGGCAGGAAGGTGGAGCTTACCAAGAGGGAG
ACCGAGCTTCTTTACTTCCTGGCTTCTCACCCCGGTCGGGTTTTTACACGGGAGTTTCTGCTCCAGCGGGTCTGGGGCTT
TGAGTTTCCCGGTAACACCCGGACCGTGGACGTGCACGTGAACCGCTTGCGCGAAAAGCTTGATGGCTTGCCCAAGTCCT
GGCACATTAAGACGGTCTGGGGCGTGGGGTACAAGCTGGTGGTAGGGGAAGATGCGCCGCATATTCGTTAA

Protein sequence :
MVTREGAATVLVVEDDRNIAELVSLYLEKHGFKVLKAASGAEALEILKNETVDLVVLDLMLPGIDGWEVCRQIRSNSQLP
VIMLTAKGELQDKLQGFELGADDYVVKPFDPQELIARVKAVLRRAGETKPRRVDLPDLTIDLESYVVEVAGRKVELTKRE
TELLYFLASHPGRVFTREFLLQRVWGFEFPGNTRTVDVHVNRLREKLDGLPKSWHIKTVWGVGYKLVVGEDAPHIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-47 48
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-44 46
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 4e-43 45
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-38 45
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-39 44
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-43 44
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 6e-37 43
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 8e-42 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 8e-42 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 8e-42 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 8e-42 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 8e-42 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 8e-42 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 8e-42 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 8e-42 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 9e-40 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 9e-40 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 9e-39 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 2e-35 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family BAC0125 Protein 5e-36 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 6e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family VFG1386 Protein 3e-35 42
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family VFG1563 Protein 3e-36 41
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family VFG1702 Protein 1e-36 41
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family VFG0596 Protein 9e-32 41
Adeg_0644 YP_003238641.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-31 41