Gene Information

Name : GYMC10_5092 (GYMC10_5092)
Accession : YP_003245112.1
Strain : Paenibacillus sp. Y412MC10
Genome accession: NC_013406
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5758850 - 5759536 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: pjd:Pjdr2_4782 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGATCCCGGATTTTGATTGTAGATGATGATGAGAAGATTATTTCCATGCTGCGCAGAGGGCTTGCGTTTGAGGGCTA
TGACGTCCTGACCGCATCCAACGGAGCAGAAGGATTGAAAGTGATATTGAGTGAAGACCCGGATGTCGTCGTTCTGGACG
TGATGATGCCTCAGGTCGATGGATTTGAAGCGCTGCGCAGACTCCGGGAGGGCGGAAGCACGATACCGGTGCTGATGCTG
ACGGCAAAGGATGAGGTGGAGAACCGGGTAAAGGGGCTGGATACCGGAGCGGATGATTATCTGGTCAAACCCTTTGCGCT
GGAGGAGCTGCTAGCCCGCGTCCGGGCTTTGCTGCGCCGTAAAACCGGGGATGATACCTCGAACCACCGACTGACCTTCG
AGGATCTCGTGATGGATACCGACGCAAGGGAGGTCATTCGCGGCGGGCAGAGACTGGAGCTCACGGCCAAGGAATTCGAG
CTGCTGCACCTGTTTATGCAAAACCCGAAGCGGGTGCTGTCCCGCGATTTGATTATGGATAAAATATGGGGCTATGACTA
CAGCGGGGAGTCGAACGTGCTGGAGGTTTATATCGCCATGCTCCGGCAGAAGACCGAGGAACATGGAGGTAAACGGCTGA
TCCAGACGATCCGCGGAGCCGGCTATATTTTAAGAGGAGATAACTAG

Protein sequence :
MRSRILIVDDDEKIISMLRRGLAFEGYDVLTASNGAEGLKVILSEDPDVVVLDVMMPQVDGFEALRRLREGGSTIPVLML
TAKDEVENRVKGLDTGADDYLVKPFALEELLARVRALLRRKTGDDTSNHRLTFEDLVMDTDAREVIRGGQRLELTAKEFE
LLHLFMQNPKRVLSRDLIMDKIWGYDYSGESNVLEVYIAMLRQKTEEHGGKRLIQTIRGAGYILRGDN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-29 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-32 46
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-28 46
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-31 45
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-30 45
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator BAC0111 Protein 9e-31 43
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-27 43
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-28 43
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-27 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-27 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-27 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-27 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-27 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-27 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-27 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-27 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-23 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-33 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator HE999704.1.gene1202. Protein 4e-25 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-21 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-24 41
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator BAC0347 Protein 7e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-44 54
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-39 46
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-32 45
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-30 43
GYMC10_5092 YP_003245112.1 winged helix family two component transcriptional regulator VFG0473 Protein 4e-19 42