Gene Information

Name : Pecwa_1390 (Pecwa_1390)
Accession : YP_003258797.1
Strain : Pectobacterium wasabiae WPP163
Genome accession: NC_013421
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator, AlpA
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1509276 - 1509488 bp
Length : 213 bp
Strand : +
Note : PFAM: prophage CP4-57 regulator; KEGG: pct:PC1_2878 phage transcriptional regulator, AlpA

DNA sequence :
ATGGCAACACAACCGACCTTACTGGAAGATCAGTTTATCGATATGAAATTTATCACCACCCTCACTGAGATGACGGATAA
ATGGTTTTATAAGCTGATTCAGGATGGTGATTTCCCTGCACCTGTTAAATTTGGCCGGAGTTCCCGTTGGCTAAAGAGTG
AAGTTGAGGTCTGGTTACAAGAGAGCATTGCCAAATCTCGTAAGCAACGCTAA

Protein sequence :
MATQPTLLEDQFIDMKFITTLTEMTDKWFYKLIQDGDFPAPVKFGRSSRWLKSEVEVWLQESIAKSRKQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 1e-19 72
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 1e-19 72
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 7e-20 71
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-19 71
unnamed AAL08466.1 unknown Not tested SRL Protein 1e-19 69
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 2e-19 68
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-19 68
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-19 68
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-13 66
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-13 66
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-16 59
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 3e-16 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pecwa_1390 YP_003258797.1 phage transcriptional regulator, AlpA VFG1057 Protein 4e-20 69
Pecwa_1390 YP_003258797.1 phage transcriptional regulator, AlpA VFG0651 Protein 7e-20 68
Pecwa_1390 YP_003258797.1 phage transcriptional regulator, AlpA VFG1480 Protein 1e-16 59