Gene Information

Name : Pecwa_3246 (Pecwa_3246)
Accession : YP_003260595.1
Strain : Pectobacterium wasabiae WPP163
Genome accession: NC_013421
Putative virulence/resistance : Virulence
Product : hemolysin expression-modulating protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3544216 - 3544419 bp
Length : 204 bp
Strand : +
Note : with Hns involved in transcriptional regulation of hemolysin; non-specific DNA-binding protein which affects the production of multiple proteins

DNA sequence :

ATGAAAAAAATCGACTATTTGATGCGTTTGCGTAAATGCACAACGATTGACACTCTCGAACGCGTTATTGAAAAAAACAA
GTATGAACTCTCCAATGATGAACTGGAGATGTTCTTTTCTGCAGCCGATCATCGCCTGGCAGAGTTGACGATGAACAAAC
TCTACGACAAAGTTCCTACCGCAGTATGGCGATACGTCCGTTAA

Protein sequence :

MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
unnamed	AAL08465.1	putative transcriptional regulator	Not tested	SRL	Protein	1e-09	53

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Pecwa_3246	YP_003260595.1	hemolysin expression-modulating protein	VFG1056	Protein	4e-10	53