Gene Information

Name : Hneap_1213 (Hneap_1213)
Accession : YP_003263096.1
Strain : Halothiobacillus neapolitanus c2
Genome accession: NC_013422
Putative virulence/resistance : Resistance
Product : merR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1316534 - 1316968 bp
Length : 435 bp
Strand : +
Note : KEGG: rme:Rmet_6344 transcriptional regulator MerR; TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: transcription regulator MerR DNA binding; regulatory protein MerR; SMART: regulatory protein MerR

DNA sequence :
ATGGAAAATACTTTGGAGAACCTAACCATTGGCGTTTTTGCCAAGGCGGCCGGCGTCAATGTGGAGACGATCCGGTTCTA
TCAGCGCAAGGGCTTGCTGCCCGAGCCGGACAAGCCTTACGGCAGCATCCGCCGCTATGGGGAGGCGGATGTAACGCGGG
TGCGGTTCGTGAAATCCGCTCAGCGGTTGGGCTTCAGCCTGGATGAAATCGCCGAGCTGCTGCGGCTCGACGATGGCACC
CACTGCGAGGAAGCCAGCAGCGTGGCCGAGCACAAGCTCAAGGACGTGCGCGAGAAGATGGCCGACTTGGCGCGCATGGA
AACCGTGCTGTCTGAACTCGTGTGCGCCTGCCATGCACGAAAGGGGAATGTTTCCTGCCCGTTGATCGCGTTACTACAGG
GCGGGGCAAGCCTGGCAGGGGCGGCGACGCCTTAG

Protein sequence :
MENTLENLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLDDGT
HCEEASSVAEHKLKDVREKMADLARMETVLSELVCACHARKGNVSCPLIALLQGGASLAGAATP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-55 97
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-55 97
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-55 97
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-55 97
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-54 96
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-54 96
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-55 94
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-55 94
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 7e-47 80
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-44 73
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-26 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hneap_1213 YP_003263096.1 merR family transcriptional regulator BAC0687 Protein 1e-55 96
Hneap_1213 YP_003263096.1 merR family transcriptional regulator BAC0232 Protein 1e-55 96
Hneap_1213 YP_003263096.1 merR family transcriptional regulator BAC0686 Protein 2e-54 95
Hneap_1213 YP_003263096.1 merR family transcriptional regulator BAC0683 Protein 1e-55 94
Hneap_1213 YP_003263096.1 merR family transcriptional regulator BAC0688 Protein 3e-56 94
Hneap_1213 YP_003263096.1 merR family transcriptional regulator BAC0684 Protein 7e-56 94
Hneap_1213 YP_003263096.1 merR family transcriptional regulator BAC0689 Protein 2e-53 92