Gene Information

Name : VEA_001641 (VEA_001641)
Accession : YP_003284269.1
Strain :
Genome accession: NC_013456
Putative virulence/resistance : Virulence
Product : two component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 35258 - 35950 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
TTGAAAATATTGATCGTCGAAGATGAGCACAAAGCCGGAGAATATCTGCAAAAAGGTTTGATTGAATCTGGGTATGTGGT
GGATTTAGTACATGATGGGGTCGATGGGCTGTATCACGCTACCAGTGAAGAATATGACTTAATCCTCCTCGACATTATGT
TGCCTAAACTCGATGGTTGGCAGGTGCTTAATACATTGCGCAGTAGTGGGATTCACACCCCAGTGATCATGCTGACAGCG
AAGGAGCAAGTGGAAGATCGCGTGCGCGGTTTTGAGCTGGGTGCCAATGACTATGTCGTAAAACCTTACGCGTTTGCGGA
GCTACTGGCGCGTATTCAAAACGTATTTCGTCATCATATTTCCGCGCAAGTGGTCGCATCGCCGCAAACATTACGTGTGG
CAGATTTAGAACTTGATATGATCAAACGCGTTGCCACGCGCGCGGGGCAGTCGATGTCGCTTACCGCCAAAGAATATGCC
CTGCTTGAGTTGTTGATGCGCAAAACTGGCCAAGTGCTTTCACGTACCACTATTGCGTCGTTAGTGTGGGATATGAACTT
TGACAGCGATACCAATGTGATTGATGTGGCGGTCAAACGTCTGCGTAGCAAAGTGGACAAACCGTTCGATAAACCACTGA
TTCACACTGTCAGAGGGATGGGCTACAAACTCGAAGAGAGTTGTGATGCCTAA

Protein sequence :
MKILIVEDEHKAGEYLQKGLIESGYVVDLVHDGVDGLYHATSEEYDLILLDIMLPKLDGWQVLNTLRSSGIHTPVIMLTA
KEQVEDRVRGFELGANDYVVKPYAFAELLARIQNVFRHHISAQVVASPQTLRVADLELDMIKRVATRAGQSMSLTAKEYA
LLELLMRKTGQVLSRTTIASLVWDMNFDSDTNVIDVAVKRLRSKVDKPFDKPLIHTVRGMGYKLEESCDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-51 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-50 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein BAC0125 Protein 4e-58 59
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein BAC0197 Protein 3e-58 58
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein BAC0083 Protein 4e-59 57
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein BAC0308 Protein 8e-58 57
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein BAC0111 Protein 8e-56 56
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein BAC0638 Protein 6e-52 56
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein BAC0347 Protein 5e-51 52
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein HE999704.1.gene1528. Protein 3e-27 42
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein NC_007793.3914065.p0 Protein 1e-28 41
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein NC_002758.1121390.p0 Protein 1e-28 41
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein NC_010079.5776364.p0 Protein 1e-28 41
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein NC_002952.2859858.p0 Protein 1e-28 41
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein NC_007622.3794948.p0 Protein 1e-28 41
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein NC_003923.1003417.p0 Protein 1e-28 41
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein NC_013450.8614146.p0 Protein 1e-28 41
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein NC_002951.3238224.p0 Protein 1e-28 41
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein AE000516.2.gene3505. Protein 2e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein VFG0596 Protein 7e-52 55
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein VFG1389 Protein 1e-30 42
VEA_001641 YP_003284269.1 two component response regulator transcription regulator protein VFG1390 Protein 3e-34 41