Gene Information

Name : Rmar_0987 (Rmar_0987)
Accession : YP_003290269.1
Strain : Rhodothermus marinus DSM 4252
Genome accession: NC_013501
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1122105 - 1122806 bp
Length : 702 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bpt:Bpet2466 two-component response regulator

DNA sequence :
ATGAGCGCGCGCATTCTGATCGTCGAAGACGATACGCCGCTGCGGGCGCTGCTGCAGGAGCGACTGGCGGCCGAGGGCTA
TGCGGTCGAGGCCGTCGCCACGGGCGAGGAAGCACTGCAGGCGCTGGAGGCCCGGCCGCCGGACCTGGTGGTGCTGGACC
TGATGCTGCCGGGTATGGACGGGCTGGAGGTGTGTCGCCGGTTGCGGGCACGCCATCCGGCCGTGTACGTGCTGATGCTC
ACGGCACGCTCGAGCGAACTGGATCGCGTGGTCGGGCTGGAAGTCGGGGCCGACGATTACGTGACCAAGCCGTTCAGCCT
GAACGAACTGGTGGCGCGCGTGCGGGCCGGATTGCGTCGGCTGCAACTGGATCGGGAGACGGCCGACGAGGCGCCGCTGG
AATTTGACGGACTGCGCATCGATCCGGTGCGACGGCAGGTCTGGCGCGACGGACAGCCCGTACACCTGACCGTCCGGGAA
TTCGAGCTGCTGCTGTTTCTGGCCCGGCATCCGGATCGGCCGTTCACCCGGCTGCAACTGCTCCGCGAGGTCTGGGGCAT
TGACTATCCCGGCTATGCGCGGACGGTCGATTCGCACATCCAGCGGCTTCGGGCCAAGATCGAACCCACCCCAGGCGCGC
CGCGCTACATCCGGACGGTCTGGGGCGTCGGCTACAAGTTTCAATCGAGTGAAGAGCCATGA

Protein sequence :
MSARILIVEDDTPLRALLQERLAAEGYAVEAVATGEEALQALEARPPDLVVLDLMLPGMDGLEVCRRLRARHPAVYVLML
TARSSELDRVVGLEVGADDYVTKPFSLNELVARVRAGLRRLQLDRETADEAPLEFDGLRIDPVRRQVWRDGQPVHLTVRE
FELLLFLARHPDRPFTRLQLLREVWGIDYPGYARTVDSHIQRLRAKIEPTPGAPRYIRTVWGVGYKFQSSEEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-31 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-30 45
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-29 48
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-29 46
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 7e-35 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-31 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-22 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 3e-21 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 5e-22 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-22 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-21 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 4e-19 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-34 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-20 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 5e-21 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator BAC0596 Protein 5e-21 44
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 5e-23 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 4e-23 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 5e-23 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-19 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-28 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator BAC0533 Protein 3e-19 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 3e-19 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 3e-19 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 3e-19 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-24 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-19 42
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-30 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-31 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-30 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-20 45
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator VFG0473 Protein 5e-21 43
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-19 41
Rmar_0987 YP_003290269.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-23 41