Gene Information

Name : Rmar_1374 (Rmar_1374)
Accession : YP_003290651.1
Strain : Rhodothermus marinus DSM 4252
Genome accession: NC_013501
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1606801 - 1607496 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: ade:Adeh_3856 two component transcriptional regulator

DNA sequence :
ATGTGGATTCTGCTGGTGGAAGACGATGAGCGGCTGGCGCGGGCGCTGGCCCGGGGGCTTCGTGAGGAAGGATACCAGGT
GGATCGGGTGGCCGACGGGGTGGAAGCGGAAGCCCGCGTGCAGGCCAGCCATTACGACGCGCTGATCGTGGACTGGCGGT
TGCCCCGGATGGACGGTCAGACGCTGGTGCGGCGCCTGCGGGAAGCCGGCTATCAGATGCCGATCCTGATGCTGACGGCG
CTGGACGACCTCGAACACCGGGTGGCCGGACTGGACGCCGGGGCCGACGATTATCTGGGTAAACCCTTCGCCTTCGAGGA
GTTGCTGGCCCGGCTGCGGGCGCTGCTGCGCCGATCGCCTGTCTGGCAGGCAACCGACGTGATCCGCCTGGGACCGCTGG
AGATCAACGAGCGGCGCCGCCAGGTCCGGGTGGGCGAGTACGTCTTGCCGCTGCGGCCCAAGGAGTACGATCTGCTGCGC
TTTCTGGCGCGTCATCCGGGCGAGGTGCTCTCGCGCACGCGGATTGCCGAGCAGGTCTGGGGCGACCCGTTCTACGTGAG
CGACAACACGATCGACGTGACCGTTTCCGGATTGCGCCAGAAACTCAGCGAGGCGACTCCGGCGTTGCAGATCGAAACCG
TCCGGGGTGTCGGCTACGCCCTGCGGCTTGAACCTTCCGCCACGGAAACGCCATGA

Protein sequence :
MWILLVEDDERLARALARGLREEGYQVDRVADGVEAEARVQASHYDALIVDWRLPRMDGQTLVRRLREAGYQMPILMLTA
LDDLEHRVAGLDAGADDYLGKPFAFEELLARLRALLRRSPVWQATDVIRLGPLEINERRRQVRVGEYVLPLRPKEYDLLR
FLARHPGEVLSRTRIAEQVWGDPFYVSDNTIDVTVSGLRQKLSEATPALQIETVRGVGYALRLEPSATETP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-28 46
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-22 45
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-27 44
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator BAC0347 Protein 5e-27 44
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-28 44
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-27 43
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-20 43
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-24 42
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-21 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-21 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-21 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-21 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-21 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-21 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-21 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-28 47
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-22 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator VFG0473 Protein 5e-21 41
Rmar_1374 YP_003290651.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-26 41