Gene Information

Name : yycF (FI9785_122)
Accession : YP_003292277.1
Strain : Lactobacillus johnsonii FI9785
Genome accession: NC_013504
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 67563 - 68270 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGCCAAAGAAGATTTTAGTCGTTGACGATGAAAAACCAATTTCTGACATTATTAAATTTAATCTGACTAAGGAAGGCTT
TGATGTCGACACTGCATATGACGGCGAAGAAGCTGTTAAAAAAGTTGAGGAATATGATCCCGATTTAATGATTCTTGACT
TGATGTTACCAAAGAAAGACGGCTTAGAGGTTGCGCGTGAAGTACGCCAAACTCATGATATGCCAATTATTATGGTAACA
GCTAAAGACACTGAAATTGACAAGGTGTTAGGTCTTGAAATGGGAGCAGATGATTATGTTACCAAGCCCTTTTCTAACCG
TGAATTAGTTGCTAGAGTAAAGGCAAACTTACGTAGACGTGACTTGACCCAAAAAGCTACTGAAGATGATGAAGATAAGA
ATATTACCATTGGCAATCTTGTGATTATGCCGGAAGCTTATATGGTTGAAAAAAATGGTGAAAAAATTGAATTAACGCAT
CGTGAATTTGAATTACTTCATTATTTAGCACAGCATATGGGACAAGTAATGACTAGAGAACATTTATTACAAACCGTTTG
GGGCTATGACTATTTTGGAGATGTTAGAACTGTGGATGTAACTGTTCGACGCTTGCGGGAAAAGATCGAAGACAATCCAA
GTTCACCAACAATTTTAGTTACCAGACGTGGAGTAGGATATTACGTTAAAAACCCATCAGATGAATAA

Protein sequence :
MPKKILVVDDEKPISDIIKFNLTKEGFDVDTAYDGEEAVKKVEEYDPDLMILDLMLPKKDGLEVAREVRQTHDMPIIMVT
AKDTEIDKVLGLEMGADDYVTKPFSNRELVARVKANLRRRDLTQKATEDDEDKNITIGNLVIMPEAYMVEKNGEKIELTH
REFELLHYLAQHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSSPTILVTRRGVGYYVKNPSDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-27 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_003292277.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-58 67
yycF YP_003292277.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-45 54
yycF YP_003292277.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-45 53
yycF YP_003292277.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-45 53
yycF YP_003292277.1 two-component system response regulator NC_007622.3794472.p0 Protein 9e-46 53
yycF YP_003292277.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-45 53
yycF YP_003292277.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-45 53
yycF YP_003292277.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-45 53
yycF YP_003292277.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-45 53
yycF YP_003292277.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-45 53
yycF YP_003292277.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-45 53
yycF YP_003292277.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-37 51
yycF YP_003292277.1 two-component system response regulator NC_012469.1.7686381. Protein 2e-33 47
yycF YP_003292277.1 two-component system response regulator AE016830.1.gene1681. Protein 3e-34 47
yycF YP_003292277.1 two-component system response regulator BAC0533 Protein 1e-30 47
yycF YP_003292277.1 two-component system response regulator NC_002695.1.915041.p Protein 7e-31 47
yycF YP_003292277.1 two-component system response regulator CP000647.1.gene4257. Protein 1e-30 47
yycF YP_003292277.1 two-component system response regulator CP000034.1.gene3834. Protein 7e-31 47
yycF YP_003292277.1 two-component system response regulator CP004022.1.gene3215. Protein 1e-29 47
yycF YP_003292277.1 two-component system response regulator AE000516.2.gene3505. Protein 5e-29 46
yycF YP_003292277.1 two-component system response regulator CP001138.1.gene4273. Protein 3e-30 46
yycF YP_003292277.1 two-component system response regulator AF155139.2.orf0.gene Protein 2e-30 45
yycF YP_003292277.1 two-component system response regulator NC_010079.5776364.p0 Protein 5e-30 45
yycF YP_003292277.1 two-component system response regulator NC_002952.2859858.p0 Protein 5e-30 45
yycF YP_003292277.1 two-component system response regulator NC_007622.3794948.p0 Protein 5e-30 45
yycF YP_003292277.1 two-component system response regulator NC_003923.1003417.p0 Protein 5e-30 45
yycF YP_003292277.1 two-component system response regulator NC_013450.8614146.p0 Protein 5e-30 45
yycF YP_003292277.1 two-component system response regulator NC_002951.3238224.p0 Protein 5e-30 45
yycF YP_003292277.1 two-component system response regulator NC_007793.3914065.p0 Protein 5e-30 45
yycF YP_003292277.1 two-component system response regulator NC_002758.1121390.p0 Protein 5e-30 45
yycF YP_003292277.1 two-component system response regulator FJ349556.1.orf0.gene Protein 4e-31 44
yycF YP_003292277.1 two-component system response regulator AM180355.1.gene1830. Protein 2e-30 43
yycF YP_003292277.1 two-component system response regulator AE015929.1.gene1106. Protein 1e-23 43
yycF YP_003292277.1 two-component system response regulator NC_010410.6002989.p0 Protein 2e-24 43
yycF YP_003292277.1 two-component system response regulator NC_010400.5986590.p0 Protein 1e-23 43
yycF YP_003292277.1 two-component system response regulator NC_011595.7057856.p0 Protein 2e-24 43
yycF YP_003292277.1 two-component system response regulator NC_014475.1.orf0.gen Protein 5e-31 41
yycF YP_003292277.1 two-component system response regulator NC_005054.2598277.p0 Protein 5e-31 41
yycF YP_003292277.1 two-component system response regulator DQ212986.1.gene4.p01 Protein 8e-30 41
yycF YP_003292277.1 two-component system response regulator AF162694.1.orf4.gene Protein 4e-30 41
yycF YP_003292277.1 two-component system response regulator CP004022.1.gene1676. Protein 3e-20 41
yycF YP_003292277.1 two-component system response regulator CP001138.1.gene2239. Protein 2e-21 41
yycF YP_003292277.1 two-component system response regulator CP000034.1.gene2186. Protein 2e-22 41
yycF YP_003292277.1 two-component system response regulator NC_002695.1.916589.p Protein 1e-22 41
yycF YP_003292277.1 two-component system response regulator BAC0596 Protein 2e-21 41
yycF YP_003292277.1 two-component system response regulator BAC0039 Protein 2e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_003292277.1 two-component system response regulator VFG1389 Protein 5e-27 43
yycF YP_003292277.1 two-component system response regulator VFG1563 Protein 6e-28 41
yycF YP_003292277.1 two-component system response regulator VFG1702 Protein 4e-28 41