Gene Information

Name : ETAE_3355 (ETAE_3355)
Accession : YP_003297397.1
Strain : Edwardsiella tarda EIB202
Genome accession: NC_013508
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3539525 - 3540253 bp
Length : 729 bp
Strand : -
Note : -

DNA sequence :
ATGGGGGAGTCGGTGATGACGGGGAAACGAATTCTGGTGGTAGAGGATGACACGCTGATTGCCGAACTGCTGACGCTGCA
TCTGTGCGATGAGGGATACCAGGTGACCCATGCCGCCGACGGCGATCGGGGGATGGCGCTGGTTGAACAGGGTGGATGGG
ATGCGCTGATCCTCGATCTGATGCTGCCGGGCGTGGATGGGCTGGATATCTGCCGCCGGGTGCGCGCCATGACCCGCTAT
ACCCCGATCATCATCACCAGCGCCCGCTCCAGCGAGGTTCACCGAGTGCTGGGGCTGGAGCTGGGGGCCGACGATTATCT
GGCCAAGCCGTTTTCTATGATTGAGTTGGTCGCCCGGGTAAAGGCGCTGTTTCGTCGCCAGGAGGCGATGGGCCGCAACC
TGATGCTGGAGGGGGGACGCCTGAGCTATGGCCCGCTGACCATCGATCCCATGGCGCGGGTGGTGTGGGTGGGAGAGCGG
CCGATCGAGCTTACGCCGCGCGAATTCGATCTGCTGTACTTCTTTGCCCGTCACCCCGGGCAGGTATTTTCACGTCTGCA
GCTATTGGACAAGGTGTGGGGATACCAGCACGACGGCTACGAGCATACGGTCAATACCCATATTAATCGCCTGCGCACCA
AGATCGAGGCCGATCCCGCCGAGCCGGCGCTGATCCTGACCGTCTGGGGCGCCGGCTACAAGTTCGCCGACGCAGGGGGA
GCGGTATGA

Protein sequence :
MGESVMTGKRILVVEDDTLIAELLTLHLCDEGYQVTHAADGDRGMALVEQGGWDALILDLMLPGVDGLDICRRVRAMTRY
TPIIITSARSSEVHRVLGLELGADDYLAKPFSMIELVARVKALFRRQEAMGRNLMLEGGRLSYGPLTIDPMARVVWVGER
PIELTPREFDLLYFFARHPGQVFSRLQLLDKVWGYQHDGYEHTVNTHINRLRTKIEADPAEPALILTVWGAGYKFADAGG
AV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-75 65
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-74 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ETAE_3355 YP_003297397.1 two-component response regulator AE000516.2.gene3505. Protein 2e-38 47
ETAE_3355 YP_003297397.1 two-component response regulator AE016830.1.gene1681. Protein 6e-47 44
ETAE_3355 YP_003297397.1 two-component response regulator NC_012469.1.7685629. Protein 8e-42 44
ETAE_3355 YP_003297397.1 two-component response regulator AF155139.2.orf0.gene Protein 6e-44 43
ETAE_3355 YP_003297397.1 two-component response regulator NC_012469.1.7686381. Protein 7e-46 42
ETAE_3355 YP_003297397.1 two-component response regulator HE999704.1.gene1528. Protein 2e-35 42
ETAE_3355 YP_003297397.1 two-component response regulator FJ349556.1.orf0.gene Protein 2e-39 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_007622.3794472.p0 Protein 9e-42 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-41 42
ETAE_3355 YP_003297397.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_010410.6002989.p0 Protein 2e-32 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_010400.5986590.p0 Protein 2e-32 41
ETAE_3355 YP_003297397.1 two-component response regulator AE015929.1.gene1106. Protein 8e-30 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_011595.7057856.p0 Protein 2e-32 41
ETAE_3355 YP_003297397.1 two-component response regulator BAC0111 Protein 8e-35 41
ETAE_3355 YP_003297397.1 two-component response regulator BAC0125 Protein 2e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator HE999704.1.gene2815. Protein 7e-41 41
ETAE_3355 YP_003297397.1 two-component response regulator CP000034.1.gene2186. Protein 3e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator NC_002695.1.916589.p Protein 3e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator BAC0596 Protein 1e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator BAC0039 Protein 3e-33 41
ETAE_3355 YP_003297397.1 two-component response regulator CP001138.1.gene2239. Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ETAE_3355 YP_003297397.1 two-component response regulator VFG1702 Protein 4e-75 65
ETAE_3355 YP_003297397.1 two-component response regulator VFG1563 Protein 3e-74 64
ETAE_3355 YP_003297397.1 two-component response regulator VFG1389 Protein 6e-32 42
ETAE_3355 YP_003297397.1 two-component response regulator VFG1390 Protein 3e-37 41