Gene Information

Name : Tcur_4043 (Tcur_4043)
Accession : YP_003301610.1
Strain : Thermomonospora curvata DSM 43183
Genome accession: NC_013510
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4620246 - 4620923 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sat:SYN_00981 response regulator

DNA sequence :
ATGAAAGGACGCGTACTGGTCGTCGACGACGACCTCGCTCTCGCCGAAATGCTCGGCATAGTCCTGCGGGGCGAGGGTTT
CGAGCCGTCGTTCGTCCACGACGGGGACAAGGCGCTTGAGGCGTTCCGGGAGACCCGGCCCGATCTCGTGCTGCTGGACC
TGATGCTGCCCGGCGCCGACGGCATCGACGTGTGCCGCCAGATCCGCGCCGAGTCCGGCGTCCCGATCGTCATGCTCACC
GCCAAGAGCGACACCGTCGACGTGGTGCTGGGGCTGGAGTCGGGCGCCGACGACTACATCGTCAAGCCGTTCAAGCCCAA
GGAACTGGTCGCCCGGATGCGCGCCAGGCTGCGCCGCACCGAAGAACCCGCCCCGGAGACGCTGCAGATCGGCGACATCA
CCATCGACGTGGCCGGGCACTCGGTCAAGCGCGGCGACAAGACCATCCCGCTGACCCCGCTGGAGTTCGACCTGCTGGTG
GCGCTGGCCCGCAAGCCCCGCCAGGTGTTCACCCGCGAGGTGCTGCTGGAGCAGGTCTGGGGCTACCGGCACGCCGCCGA
CACCCGGCTGGTGAACGTCCATGTGCAGCGGCTGCGCGCCAAGATCGAAAAGGACCCGGAGCACCCGGAGATCGTGGTGA
CGGTCCGCGGCGTCGGCTACAAGGCCGGCCCCGCCTGA

Protein sequence :
MKGRVLVVDDDLALAEMLGIVLRGEGFEPSFVHDGDKALEAFRETRPDLVLLDLMLPGADGIDVCRQIRAESGVPIVMLT
AKSDTVDVVLGLESGADDYIVKPFKPKELVARMRARLRRTEEPAPETLQIGDITIDVAGHSVKRGDKTIPLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKIEKDPEHPEIVVTVRGVGYKAGPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-79 77
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-46 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-45 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-45 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-45 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-45 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-45 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-46 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-45 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-46 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-45 47
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-44 46
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-44 45
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-42 45
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-35 44
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-36 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-42 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 3e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 7e-41 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-40 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 9e-41 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator BAC0596 Protein 7e-41 43
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-36 42
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-39 45
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-31 45
Tcur_4043 YP_003301610.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-39 41