Gene Information

Name : Tcur_0700 (Tcur_0700)
Accession : YP_003298331.1
Strain : Thermomonospora curvata DSM 43183
Genome accession: NC_013510
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 781392 - 782072 bp
Length : 681 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sat:SYN_00981 response regulator

DNA sequence :
GTGACTCGTGTGCTCGTCGTGGAAGACGAAGAGTCGTTCAGCGACGCGCTGTCCTACAACCTCCGCAAGGAGGGCTTTGA
GGTGGCGGTCGCCTCCACCGGCCCGGACGCACTGGAGATCTTCGACCGCAACGGCGCCGACCTGGTGCTGCTGGACCTGA
TGCTGCCGGGCCTGCCGGGCACCGAGGTGTGCCGGGAGCTGCGCGCCCGCTCCAACGTGCCGGTGATCATGCTGACCGCC
AAGGACAGCGAGGTGGACAAGGTGGTCGGCCTGGAGCTGGGCGCCGACGACTATGTCACCAAGCCCTTTTCCACCCGCGA
GCTGATCGCCCGCATGCGCGCCGTGCTGCGCCGCCGCGGCGACGCCGAAGAGCCCCCGCCGTCCGTCCTGGAGGCCGGCC
CCGTCCGCATGGACGTCGAGCGGCACGTGGTCACCGTCGACGGCGAGGCCGTCCAGCTGCCGTTGAAGGAGTTCGAGCTG
CTGGAGGTCCTGCTGCGCAACGCCGGGCGGGTGCTGACCCGGATGCAGCTGATCGACCGGGTATGGGGCGCCGACTACGT
GGGCGACACCAAGACGCTGGACGTCCACATCAAGCGCCTGCGCGCCAAGATCGAGCCGGTTCCGTCCTCGCCGCGCTACA
TCGTCACCGTGCGCGGCCTGGGCTACAAGTTCGAGCCCTGA

Protein sequence :
MTRVLVVEDEESFSDALSYNLRKEGFEVAVASTGPDALEIFDRNGADLVLLDLMLPGLPGTEVCRELRARSNVPVIMLTA
KDSEVDKVVGLELGADDYVTKPFSTRELIARMRAVLRRRGDAEEPPPSVLEAGPVRMDVERHVVTVDGEAVQLPLKEFEL
LEVLLRNAGRVLTRMQLIDRVWGADYVGDTKTLDVHIKRLRAKIEPVPSSPRYIVTVRGLGYKFEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 1e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-45 49
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-40 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-35 48
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-41 46
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-40 46
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-43 45
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-28 44
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator BAC0308 Protein 9e-28 42
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-28 42
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-28 41
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-28 41
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator BAC0638 Protein 4e-20 41
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-27 41
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-30 44
Tcur_0700 YP_003298331.1 winged helix family two component transcriptional regulator VFG1386 Protein 8e-29 43