Gene Information

Name : Sthe_2197 (Sthe_2197)
Accession : YP_003320443.1
Strain :
Genome accession: NC_013523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2448969 - 2449679 bp
Length : 711 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: hau:Haur_0905 two component transcriptional regulator

DNA sequence :
ATGACGACGATCCTGCTGGTGGAAGACGCCCGCGACCTCGCCCAGGTGATCGAGCGCGAACTCACCGCGGCCGGATACCG
TGTCGTGCTGGCCTACGACGGGCGGACGGCGCTCGACCTGCTTGCCCGCGAGCAACCCGACCTGGTCGTGCTCGACTGGA
TGCTCCCCCAGGTCGACGGGCTTGAGGTGCTGCGCCGGCTGCGACAGGAGTCCCCGACGCCGGTCCTGATGCTGACGGCG
CGGAGTGAGGAGGTCGATCGGGTCGTCGGGCTGGAGCTGGGGGCCGACGACTACCTGACCAAGCCGTTCAGCATGCGCGA
GTTGCTCGCGCGCGTCCGGGCCCTGCTGCGACGCACCGACCTCGTGCGGCAGATGCTGGAGGCCGACCGGAAGGCGAGCA
CGGAGGCGGTGCGCTACGGCCCGCTGGCGCTCGACCCCGTGCGGCACATCGCCACCCTGGACGGCCAGGAGCTGGATCTG
ACGCCGACCGAGTTCCGCCTGTTGCACCTGCTGATGCGTCATCCGGGCCGCGCCTTCGGGCGGAGCTACCTGCTCGACAC
CATCTGGGGCGATCAGTTCGTCGGCGAGCGCTCGGTTGACAACGCCGTGCTGCGGCTCCGGAAGAAGCTGGGGCCGCTCG
GTGAAGCGATCGAGACCGTCTGGGGCGTCGGCTACCGGCTGCGCGCGACCGACGTGCGGGAGGGCCCATGA

Protein sequence :
MTTILLVEDARDLAQVIERELTAAGYRVVLAYDGRTALDLLAREQPDLVVLDWMLPQVDGLEVLRRLRQESPTPVLMLTA
RSEEVDRVVGLELGADDYLTKPFSMRELLARVRALLRRTDLVRQMLEADRKASTEAVRYGPLALDPVRHIATLDGQELDL
TPTEFRLLHLLMRHPGRAFGRSYLLDTIWGDQFVGERSVDNAVLRLRKKLGPLGEAIETVWGVGYRLRATDVREGP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 1e-23 45
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 2e-27 44
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 2e-27 44
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-36 44
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 8e-30 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 2e-27 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 1e-30 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 4e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-34 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 2e-29 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 2e-29 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 1e-29 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family BAC0596 Protein 2e-29 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family BAC0039 Protein 2e-29 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 7e-29 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 5e-28 43
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 1e-27 42
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-39 42
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family BAC0533 Protein 4e-27 42
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 4e-27 42
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 9e-30 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 9e-30 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 9e-30 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 9e-30 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 9e-30 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 9e-30 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 9e-30 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 9e-30 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 5e-26 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-29 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 1e-32 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 1e-32 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 1e-32 41
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-25 42
Sthe_2197 YP_003320443.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-31 42