Gene Information

Name : Tter_1435 (Tter_1435)
Accession : YP_003323163.1
Strain :
Genome accession: NC_013525
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1561201 - 1561902 bp
Length : 702 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 two component transcriptional regulator, winged helix family

DNA sequence :
ATGTCTAACCAGCAGGCAAGAATCTTAGTAATCGAGGACGAACATCAAATAGCTGACCTTCTGCGCAGAGGGCTAACGTT
TAAGGGTTACCTGGTCGATACTGCAGCTTCAGGCGAAGAGGGGCTGGATAAGGCCAGGGATAATCCTCCCGATCTCGTAA
TCTTGGACCTAATGCTTCCTGAGATGAGTGGGGAAGAGGTATGCAGGCGGCTGCGAGAAGGACTAGATCCTGATTTGCCT
ATTATTATTCTTACTGCGAAGGACGCAACTGAAGACAAGATAGCAGGCCTTGATGCTGGTGCAGATGATTACATAACTAA
GCCGTTCAATTTTGAGGAGCTTCTGGCGCGGATCAGAGCTTCATTGAGGAGGAGGCAGCCTCAGGAGAAGAGTATCATCA
GAGTTGGTGATCTAACTCTCAACCTAGCTTCTAGAGAGGCTATGAGGGGTGAGCGTAAGCTTGATCTTACTACACGTGAG
TTTGACTTGTTGGAATTCTTGGCTCGCAACGAGGGGCACGTTGTAAGTAAAGAGGCCATATTCGAACGTGTATGGGGTTA
TTCCTTTGACATAGACTCTGATGCCGTAAAAGTCTACATAAGCTACCTACGTTCCAAGCTAACGGCTGGCGGCGAGCCCG
ATATGATACACACCATACGGGGCATAGGATATATGCTAAGGGCTCCCCAGCCCGTTAAGTGA

Protein sequence :
MSNQQARILVIEDEHQIADLLRRGLTFKGYLVDTAASGEEGLDKARDNPPDLVILDLMLPEMSGEEVCRRLREGLDPDLP
IIILTAKDATEDKIAGLDAGADDYITKPFNFEELLARIRASLRRRQPQEKSIIRVGDLTLNLASREAMRGERKLDLTTRE
FDLLEFLARNEGHVVSKEAIFERVWGYSFDIDSDAVKVYISYLRSKLTAGGEPDMIHTIRGIGYMLRAPQPVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-29 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-27 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-29 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-41 48
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-41 48
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-41 48
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-41 48
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-41 48
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-41 48
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-41 48
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-41 48
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 6e-36 46
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family BAC0083 Protein 8e-37 44
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family BAC0197 Protein 4e-37 44
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family BAC0125 Protein 5e-38 43
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 6e-30 42
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 6e-28 42
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 6e-28 42
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family BAC0111 Protein 2e-37 42
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-30 42
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-31 42
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family BAC0308 Protein 7e-36 42
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 9e-37 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-34 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 8e-35 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family BAC0638 Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family VFG1390 Protein 8e-51 50
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family VFG1386 Protein 2e-41 45
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family VFG1389 Protein 3e-39 43
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family VFG0596 Protein 8e-33 42
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family VFG1702 Protein 1e-29 41
Tter_1435 YP_003323163.1 two component transcriptional regulator, winged helix family VFG1563 Protein 6e-29 41