Gene Information

Name : DhcVS_926 (DhcVS_926)
Accession : YP_003330373.1
Strain : Dehalococcoides sp. VS
Genome accession: NC_013552
Putative virulence/resistance : Virulence
Product : two-component system, OmpR family, response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 857738 - 858421 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGACTAAGCAAATACTGATAGCGGATGACGAAAAAAGGATAGCAGAAATCCTGCAAGCCTATCTTGAACGTGAAGGCTT
CATGGTGGTTGTAACCTATGACGGAAAAACAGCTCTGGCAAAATTCCATGAAGAAAACCCTGACCTGATAATACTTGACT
TGATGCTACCCGAAATATCCGGCTGGGATGTCTGCCGTGAAATCCGCAAAGAAAGCCGCGTACCTATAATAATGCTTACC
GCTCGTGATGAACTTACCGACAAGCTGATAGGATTGGAAATTGGGGCGGATGATTATATGACCAAACCCTTTGAGGCCAA
AGAACTGGTAGCCCGCGTCAAAGCTCAGCTCAGACGGTCTGAATACACTCCCAGCCTTGACTCAGTACTGATTATTGACC
AGCTGGAAATAGACAAGGCACGGCGCCTGGTTAAAATAGGCGGTAAGGCGGTTGATTTGACCGCCACCGAGTTCGATATA
CTGATAAACCTTGCTGCAAGCCCGGGACGTGTCTTTTCCCGTATGCAGATACTGGACAAACTGGGTGAAGCTTACGAAGG
ATATGAACGTACCATAGACAGCCATATTAAAAATCTGCGTAAAAAAATAGAGCCTGATCCCGAATCCCCTGCCTATATCC
TGACCATACACGGGGTAGGCTACAAGATGAAAGATAAAGGATAA

Protein sequence :
MTKQILIADDEKRIAEILQAYLEREGFMVVVTYDGKTALAKFHEENPDLIILDLMLPEISGWDVCREIRKESRVPIIMLT
ARDELTDKLIGLEIGADDYMTKPFEAKELVARVKAQLRRSEYTPSLDSVLIIDQLEIDKARRLVKIGGKAVDLTATEFDI
LINLAASPGRVFSRMQILDKLGEAYEGYERTIDSHIKNLRKKIEPDPESPAYILTIHGVGYKMKDKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-35 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_012469.1.7685629. Protein 1e-44 49
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator HE999704.1.gene2815. Protein 9e-40 47
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator AE000516.2.gene3505. Protein 3e-37 47
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator AM180355.1.gene1830. Protein 1e-37 45
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator BAC0596 Protein 1e-41 45
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator CP001138.1.gene2239. Protein 1e-41 45
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_002695.1.916589.p Protein 3e-41 44
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator BAC0039 Protein 4e-41 44
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator CP000034.1.gene2186. Protein 4e-41 44
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator CP001918.1.gene3444. Protein 1e-40 44
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator CP000647.1.gene2531. Protein 9e-42 44
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_002952.2859905.p0 Protein 1e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_013450.8614421.p0 Protein 2e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_007793.3914279.p0 Protein 2e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_007622.3794472.p0 Protein 1e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_002745.1124361.p0 Protein 2e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_009782.5559369.p0 Protein 2e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_002951.3237708.p0 Protein 2e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_003923.1003749.p0 Protein 2e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_002758.1121668.p0 Protein 2e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_009641.5332272.p0 Protein 2e-40 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_010410.6002989.p0 Protein 3e-39 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_010400.5986590.p0 Protein 1e-38 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_011595.7057856.p0 Protein 3e-39 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator FJ349556.1.orf0.gene Protein 4e-34 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator AF155139.2.orf0.gene Protein 1e-36 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator CP004022.1.gene1676. Protein 2e-35 43
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator AE015929.1.gene1106. Protein 4e-28 42
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator DQ212986.1.gene4.p01 Protein 2e-36 42
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator CP000675.2.gene1535. Protein 3e-43 42
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator AF162694.1.orf4.gene Protein 5e-32 42
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_014475.1.orf0.gen Protein 4e-35 42
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_005054.2598277.p0 Protein 4e-35 42
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_013450.8614146.p0 Protein 3e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_002951.3238224.p0 Protein 3e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_007793.3914065.p0 Protein 3e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_002758.1121390.p0 Protein 3e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_010079.5776364.p0 Protein 3e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_002952.2859858.p0 Protein 3e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_007622.3794948.p0 Protein 3e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator NC_003923.1003417.p0 Protein 3e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator AF130997.1.orf0.gene Protein 2e-32 41
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator EU250284.1.orf4.gene Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator VFG1563 Protein 3e-35 44
DhcVS_926 YP_003330373.1 two-component system, OmpR family, response regulator VFG1702 Protein 6e-36 44