Gene Information

Name : Dd586_0404 (Dd586_0404)
Accession : YP_003332005.1
Strain : Dickeya dadantii Ech586
Genome accession: NC_013592
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator AlpA
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 462842 - 463054 bp
Length : 213 bp
Strand : -
Note : PFAM: Prophage CP4-57 regulatory; KEGG: pct:PC1_2878 phage transcriptional regulator, AlpA

DNA sequence :
ATGACCAGCGAACCCAGTCTGCTCAAAGATCAATTCGTCGATATGGCGTTTATCACCAAATTGACCGGATTAACCGACAA
ATGGTTTTACAAGCTGATTCAGGACGGCACATTTCCACCCCCCATCAAATTTGGTCGCCGCTCCCGCTGGCTGCAAAGTG
AAGTGGAAGCCTGGCTCCAGCGCCGTATCGAACAATCCCGAGTATCACAATGA

Protein sequence :
MTSEPSLLKDQFVDMAFITKLTGLTDKWFYKLIQDGTFPPPIKFGRRSRWLQSEVEAWLQRRIEQSRVSQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 6e-21 78
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-20 77
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 4e-20 77
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 4e-20 77
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-20 75
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 9e-21 75
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-20 75
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-20 74
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 1e-16 58
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-16 58

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd586_0404 YP_003332005.1 phage transcriptional regulator AlpA VFG0651 Protein 4e-21 75
Dd586_0404 YP_003332005.1 phage transcriptional regulator AlpA VFG1057 Protein 1e-20 74
Dd586_0404 YP_003332005.1 phage transcriptional regulator AlpA VFG1480 Protein 5e-17 58