Gene Information

Name : Tnap_1151 (Tnap_1151)
Accession : YP_003346651.1
Strain : Thermotoga naphthophila RKU-10
Genome accession: NC_013642
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1178743 - 1179462 bp
Length : 720 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: trq:TRQ2_1174 two component transcriptional regulator

DNA sequence :
ATGGCGAAAAAGAAGATTCTGGTGGTTGACGACGACCCGGCAATTCTCGAGCTGGTAGGATACAACCTTTCCAAAGAAGG
ATACGAGGTGCTCAAGGCTTACGATGGAGAAGAAGCACTCAAAATTGCCAACGACGAGGATGTGGATATGTTCATAGTGG
ATATCATGCTTCCTGGAATTGACGGTTTCGAGCTGGTCAGGAAGATCAGGGCTATAGAGAAATACAAGAACACCCCCGTG
ATCTTCCTGAGCGCGAAGGGAGAAGAATTCGACAAGGTGCTTGGGCTGGAGCTCGGTGCGGACGACTACATCACCAAGCC
GTTCAGCGTGAGAGAGCTTCTTGCGAGGGTGAAGGCTGTATTCAGAAGACTTTCCGCCGCAACTCAGAGCAAGGAAGAAA
GGCCTAAGAAGATCATAGCCAGGGATCTTGAAATCGATGTGGAAAAGTACGAAGTGAAAGTGAGGGGGAAAAAGGTGAAC
CTCACTCCTCTCGAATTCGAATTGCTCAGGTTCCTCGCGGAGAACGAAGGAAAGGTTTTCAGCAGGGATGTGCTTCTGGA
CAAGCTCTGGGGATACGATTACTATGGAGACACAAGAACGGTGGACGTTCACATAAGAAGGCTGAGAACGAAGATAGAAG
AAGATCCTTCGAATCCGAAATACATAATCACTGTGAGAGGAAAGGGATACAAATTCAGAGATCCCGGAAAGGAAGACTGA

Protein sequence :
MAKKKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDVDMFIVDIMLPGIDGFELVRKIRAIEKYKNTPV
IFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAVFRRLSAATQSKEERPKKIIARDLEIDVEKYEVKVRGKKVN
LTPLEFELLRFLAENEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSNPKYIITVRGKGYKFRDPGKED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-44 48
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-43 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 4e-54 52
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-49 50
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 6e-54 49
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 6e-47 48
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-46 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 4e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 5e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 5e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 4e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 5e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 5e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 5e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 5e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 6e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 5e-49 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 9e-42 45
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 4e-45 45
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 4e-45 45
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-40 44
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-43 43
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 3e-41 43
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 2e-38 43
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 2e-38 43
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-35 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-35 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-35 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-35 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-29 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-35 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-35 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-35 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-35 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-31 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family BAC0125 Protein 6e-34 41
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 6e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family VFG1702 Protein 3e-44 48
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family VFG1563 Protein 7e-44 47
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family VFG1389 Protein 7e-33 43
Tnap_1151 YP_003346651.1 two component transcriptional regulator, winged helix family VFG1386 Protein 3e-38 41