Gene Information

Name : ROD_12871 (ROD_12871)
Accession : YP_003364873.1
Strain : Citrobacter rodentium ICC168
Genome accession: NC_013716
Putative virulence/resistance : Unknown
Product : ISCro1 transposase B
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1384085 - 1384432 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
ATGATATCTCTCCCTGCAGGTTCGCGTATCTGGCTGGTTGCAGGTATCACCGATATGCGAAATGGCTTTAACGGCCTGGC
ATCAAAAGTTCAGAACGTCCTGAAGGATGACCCGTTCTCCGGACACCTGTTCATCTTCCGCGGACGCCGGGGTGACCAGA
TAAAAGTGTTGTGGGCTGACAGTGACGGACTGTGCCTCTTCACCAAACGCCTGGAGCGGGGCCGCTTCATCTGGCCAGTC
ACCCGTGACGGCAAGGTGCACCTTACTCCGGCTCAGTTATCCATGCTTCTTGAAGGTATCAACTGGAAGCACCCGAAACG
AACGGAACGCGCTGGAATCCGCATATAA

Protein sequence :
MISLPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLFIFRGRRGDQIKVLWADSDGLCLFTKRLERGRFIWPV
TRDGKVHLTPAQLSMLLEGINWKHPKRTERAGIRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-49 99
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-50 99
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-50 99
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-45 81
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-45 81
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-39 77
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-39 77
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-30 76
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-39 76
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-39 76
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-39 76
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-39 76
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-39 76
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-39 76
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-38 76
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-39 76
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-38 76
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-39 76
unnamed AAL08461.1 unknown Not tested SRL Protein 7e-39 75
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-38 71
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-38 71
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 7e-38 70
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 7e-38 70
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-38 70
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-30 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ROD_12871 YP_003364873.1 ISCro1 transposase B VFG1665 Protein 4e-50 99
ROD_12871 YP_003364873.1 ISCro1 transposase B VFG1698 Protein 4e-40 77
ROD_12871 YP_003364873.1 ISCro1 transposase B VFG1517 Protein 9e-31 76
ROD_12871 YP_003364873.1 ISCro1 transposase B VFG1709 Protein 2e-39 76
ROD_12871 YP_003364873.1 ISCro1 transposase B VFG0792 Protein 2e-39 76
ROD_12871 YP_003364873.1 ISCro1 transposase B VFG1052 Protein 3e-39 75
ROD_12871 YP_003364873.1 ISCro1 transposase B VFG1737 Protein 4e-39 70