Gene Information

Name : grlR (ROD_30061)
Accession : YP_003366512.1
Strain : Citrobacter rodentium ICC168
Genome accession: NC_013716
Putative virulence/resistance : Virulence
Product : GrlR, global regulator of LEE repressor
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3174336 - 3174674 bp
Length : 339 bp
Strand : -
Note : negative regulator of LEE gene expression

DNA sequence :
ATGAAGGATGGCATCTATAGTATTACCTTTATTAGTAATGAAGATTCCTGTGGGGAAGGCATACTGATTAAAAATGGAAA
TTTAATCACTGGTGGAGATATTTCCTCTGTGTATCAGGGGGGACTGACTGAAGAGGAAGACATCATATTTCATGTTCATC
GATATAATCATGAAATTCCCTCGGTGCTGAGCATTGAACAAGATTATCAATTAGTTATCCCTAAAAAAATACTAAGTAAT
GATAATAATGTTACATTACATTGCCACGTAAGAGGAAATGAAAAGTTATTTGTTGATGTTTATGTCAGATTTATCGAACC
GTTAATTATTAAAAATTAA

Protein sequence :
MKDGIYSITFISNEDSCGEGILIKNGNLITGGDISSVYQGGLTEEEDIIFHVHRYNHEIPSVLSIEQDYQLVIPKKILSN
DNNVTLHCHVRGNEKLFVDVYVRFIEPLIIKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL06359.1 unknown Not tested LEE Protein 7e-48 100
unnamed AAK26705.1 unknown Not tested LEE Protein 1e-45 92
grlR YP_003223485.1 negative regulator GrlR Not tested LEE Protein 4e-45 92
unnamed AAL57532.1 unknown Not tested LEE Protein 1e-45 92
grlR YP_003232143.1 negative regulator GrlR Not tested LEE Protein 2e-45 92
st14 CAC81852.1 ST14 protein Not tested LEE II Protein 1e-45 92
unnamed CAI43884.1 hypothetical protein Not tested LEE Protein 3e-45 92
unnamed AAC38374.1 Orf10 Not tested LEE Protein 1e-43 89
grlR YP_003236098.1 negative regulator GrlR Not tested LEE Protein 2e-43 89
unnamed AAC31523.1 L0044 Not tested LEE Protein 1e-43 88
Z5129 NP_290278.1 negative regulator GrlR Not tested LEE Protein 2e-43 88
unnamed ACU09468.1 type three secretion system protein GrlR Virulence LEE Protein 1e-43 88
ECs4578 NP_312605.1 negative regulator GrlR Not tested LEE Protein 2e-43 88
grlR AFO66337.1 putative LEE-encoded negative regulator of transcription Not tested SESS LEE Protein 7e-23 51
grlR AFO66405.1 putative LEE-encoded negative regulator of transcription Virulence SESS LEE Protein 7e-23 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
grlR YP_003366512.1 GrlR, global regulator of LEE repressor VFG0720 Protein 4e-44 89
grlR YP_003366512.1 GrlR, global regulator of LEE repressor VFG0822 Protein 6e-44 88