Gene Information

Name : Kfla_1624 (Kfla_1624)
Accession : YP_003379518.1
Strain : Kribbella flavida DSM 17836
Genome accession: NC_013729
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1714056 - 1714733 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sat:SYN_00981 response regulator

DNA sequence :
ATGCGGGGCCGCATCCTCATCGTCGACGACGACACGGCGTTGTCGGAGATGCTCAGCATCGTGCTGCGCAACGAGGGCTA
CGACACCTATCTGTGCGCGACCGGTGACAAGGCGGTACCGGCGTTCCGCGAGTTCAAGCCCGACCTGCTGCTGCTCGACC
TGATGCTGCCCGGGATGGACGGCATCGACGTCTGCCGGGCGATCCGGGCCGAGTCCGGCGTACCGATCGTGATGCTGACC
GCGAAGAGCGACACCGTGGACGTCGTGCTCGGGCTGGAGTCCGGTGCCGACGACTACGTGGTCAAGCCGTTCAAGCCCAA
GGAGCTGGTGGCCCGGATCCGCGCCCGGCTGCGGCGGATGGACGAGCCCGGCCCGGAGTCGCTGACCATCGGCGACCTGA
CCATCGACGTGGCCGGACACTCGGTGAAGCGCAGCGGCGAGACCATCCAGCTCACCCCGCTGGAGTTCGACCTGCTGGTC
TGCCTGGCCTCCAAGCCGTGGCAGGTGTTCACCCGTGAGGTGCTGCTCGAGCAGGTCTGGGGCTACCGGCACGCCGCCGA
CACCCGGCTGGTCAACGTGCACGTCCAGCGGCTGCGGTCCAAGATCGAGAAGGACCCCGAGCACCCGGAGATCGTGGTGA
CGGTCCGCGGCGTCGGTTACAAGGCGGGTGCGGACTGA

Protein sequence :
MRGRILIVDDDTALSEMLSIVLRNEGYDTYLCATGDKAVPAFREFKPDLLLLDLMLPGMDGIDVCRAIRAESGVPIVMLT
AKSDTVDVVLGLESGADDYVVKPFKPKELVARIRARLRRMDEPGPESLTIGDLTIDVAGHSVKRSGETIQLTPLEFDLLV
CLASKPWQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKIEKDPEHPEIVVTVRGVGYKAGAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-23 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 9e-68 75
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-37 47
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-37 45
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-33 44
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-29 44
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-29 44
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-32 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-32 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-32 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-32 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-32 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-32 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-32 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-32 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-34 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-25 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator BAC0039 Protein 7e-29 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-28 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 7e-29 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 3e-28 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-28 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-29 42
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-23 42
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-27 41
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-27 41
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-29 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-26 43
Kfla_1624 YP_003379518.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-23 43