Gene Information

Name : Kfla_0268 (Kfla_0268)
Accession : YP_003378191.1
Strain : Kribbella flavida DSM 17836
Genome accession: NC_013729
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 273476 - 274144 bp
Length : 669 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAACCGGATTCTGATCGCCGAGGACGAGCAGCGGATCGCGTCGTTCGTCGAGCGGGGACTGCGCAGCAACGGTTTCGT
CACCACGGTCGTGGCGGACGGCGAAACGGCGTACCAGGAAGGGGTGAGTGGCGGCTACGACCTGCTGCTGCTCGACCTCG
GCCTGCCGCGGGTGGACGGGTTCACCGTGCTGCGGCGGCTGCGGGAGGCGCGGGTGACGATGCCGGTGGTGATCTTGACC
GCACGGGACGGGGTGCGCGACACGGTCGCCGGGCTGGAAGGTGGGGCCGACGACTACATCGCCAAGCCGTTCGCCTTCGA
GGAACTGCTGGCGCGGGTCCGGCTCCGGTTGCGCAGCGACGGCTCCGGCACGGCCGACGCGAACATCCTGCAGGTCGGCG
ACCTCAGCCTTGACCTGCGCACCCGCCGCGCCTCCGTCGACGGCCGCACGGTCGACCTCACCGCCCGGGAGTTCCTGCTC
GCCGAGGTCTTCTGCCGGCACCCCGACCAGGTGCTGTCCCGCGAACAACTGCTGTCCCAGGTCTGGGGCTTCGACTTCGA
TCCCGGCTCGAACGTGGTCGACGTCTACATTCGCTACCTGCGCCGCAAGCTGGGGCCCGACCGCATCCAGACCATCCGAG
GCATGGGCTACCGCCTCCGCCCCGGCTGA

Protein sequence :
MNRILIAEDEQRIASFVERGLRSNGFVTTVVADGETAYQEGVSGGYDLLLLDLGLPRVDGFTVLRRLREARVTMPVVILT
ARDGVRDTVAGLEGGADDYIAKPFAFEELLARVRLRLRSDGSGTADANILQVGDLSLDLRTRRASVDGRTVDLTAREFLL
AEVFCRHPDQVLSREQLLSQVWGFDFDPGSNVVDVYIRYLRRKLGPDRIQTIRGMGYRLRPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-33 48
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-31 48
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-31 45
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-27 44
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-20 44
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-28 43
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-28 43
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-33 43
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-30 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-30 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-30 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-27 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-30 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-30 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-30 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-30 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-30 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-34 48
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-27 42
Kfla_0268 YP_003378191.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-32 42