Gene Information

Name : Kfla_6884 (Kfla_6884)
Accession : YP_003384672.1
Strain : Kribbella flavida DSM 17836
Genome accession: NC_013729
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 7376268 - 7376960 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: pca:Pcar_3081 two component signal transduction response regulator

DNA sequence :
ATGCGGGTACTCGTGGTGGACGACGACCGGGCGGTCCGGGACTCGCTGCGCCGTTCGCTGGAGTTCAACGACTTCGAGGT
GGTCACCGCCTCCGACGGCGCCGAGGCGCTCGCGGTGATCGGCAACGTCGACCCCGACGTGGTCGTGATGGACGTGATGA
TGCCCCGGCTGGACGGGCTGGAGACCACCAAGGCGTTGCGGGCCGCGGGCAACAACGTGCCGATCCTGGTGCTGACCGCA
CGGGACGCGGTCGCCGACCGGGTGGACGGCCTGGACGCCGGCGGCGACGACTACCTGACCAAGCCGTTCGCGCTGGAGGA
GCTGCTGGCCCGGCTGCGCGCCCTGCTGCGGCGCAGCGCGGCCCCCGGCGAAGGCGGCCCACGCGGCGAGATCCTGCAGT
ACGCCGACCTGGTGGTCGACGTGGACGCGCACGAGGTGCACCGCGGCGACGTGCCGATCCAGCTCACCCGGACCGAGTTC
TCCCTGCTCGAGCTGCTGATCCGCAACCCGCGCCGGGTGCTGGAGCGCGCGGTGATCCTGGACGCGGTCTGGGGCTACGA
CTTCCCGACCACGGCGAACTCGCTCGAGGTCTACATCGGCTACCTGCGCCGCAAGACCGAGGTGAACGGCCTGCCCCGGC
TGATCCACACCGTGCGCGGCATCGGCTACGTGCTCCGGGACACTCCGCCGTGA

Protein sequence :
MRVLVVDDDRAVRDSLRRSLEFNDFEVVTASDGAEALAVIGNVDPDVVVMDVMMPRLDGLETTKALRAAGNNVPILVLTA
RDAVADRVDGLDAGGDDYLTKPFALEELLARLRALLRRSAAPGEGGPRGEILQYADLVVDVDAHEVHRGDVPIQLTRTEF
SLLELLIRNPRRVLERAVILDAVWGYDFPTTANSLEVYIGYLRRKTEVNGLPRLIHTVRGIGYVLRDTPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-19 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-24 49
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-17 47
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-22 45
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator BAC0308 Protein 8e-22 45
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 8e-28 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-23 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-22 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-22 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-18 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-22 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-22 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-22 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-22 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-22 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-22 42
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-51 64
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-35 50
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-32 49
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-20 43
Kfla_6884 YP_003384672.1 winged helix family two component transcriptional regulator VFG0473 Protein 9e-16 42