Gene Information

Name : Kfla_0931 (Kfla_0931)
Accession : YP_003378835.1
Strain : Kribbella flavida DSM 17836
Genome accession: NC_013729
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 995853 - 996518 bp
Length : 666 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: ade:Adeh_2914 two component transcriptional regulator

DNA sequence :
ATGAGCGGCGCCGTCAGGATTCTGTTGGTCGAAGACGATCTCGATATCGCCAACGCTCTGATACCTGCCTTGCGCCGGTA
CGGGCTGATGGTGACGCACGTCCGCACCGCCGCGGACGCGCTCGCTGCCGACCCCGGAGACCTGGTGCTGCTGGACCTCG
GACTGCCCGACGGCGACGGCATCAACGTCTGCCGGCAGATCCGCACGGTGTCCGACGTACCGGTGATCGCGGTGACCGCG
CGCGGAGAGGCGGCCGACCGGGTGCGCGGGCTGCGCAGCGGCGCGGACGACTACGTGGTGAAGCCGTTCGCGATCTCCGA
GCTGCTCGCCCGGATCGACGCCGTACTGCGGCGGACCGGGCTGCTGCAACCTCGCCCCCGGGTCACCGTGGGCGACCTGA
CCGTGGACATCGAGGCCCGGACCGTGCAGGTCGCCGACAAGCCCATCAGCCTGACCCGCAAGGAGTTCGACGTGCTCGCT
GTGCTGGCCGCGCACCACGGCCGGGTGGTGCCGCGTGAACAGGTCGCGCTGTACGCCTGGCAGTCCGTCTTCGAGGCCTC
GTCGCGGACCATGGACGTGCACGTCGCGAGCCTGCGCGCCAAGCTCGGCCGGCCCGAGCTGGTGCAGACGATCCGCGGCG
TCGGCTACCGCCTCGGTTCGGACTGA

Protein sequence :
MSGAVRILLVEDDLDIANALIPALRRYGLMVTHVRTAADALAADPGDLVLLDLGLPDGDGINVCRQIRTVSDVPVIAVTA
RGEAADRVRGLRSGADDYVVKPFAISELLARIDAVLRRTGLLQPRPRVTVGDLTVDIEARTVQVADKPISLTRKEFDVLA
VLAAHHGRVVPREQVALYAWQSVFEASSRTMDVHVASLRAKLGRPELVQTIRGVGYRLGSD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-28 45
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 9e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-27 42
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-28 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-28 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-28 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-28 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-28 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-28 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-24 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-28 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-28 41
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-28 45
Kfla_0931 YP_003378835.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-27 44